[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54801.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:97 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->97 3bguB PDBj 8e-51 100.0 %
:RPS:PDB   1->97 3bguB PDBj 1e-21 99.0 %
:RPS:SCOP  3->94 1x8dA1  d.58.4.21 * 1e-04 10.2 %
:HMM:SCOP  3->98 1tr0A_ d.58.4.4 * 9.8e-23 33.3 %
:RPS:PFM   3->95 PF07876 * Dabb 1e-12 33.7 %
:HMM:PFM   3->95 PF07876 * Dabb 1.3e-22 33.3 93/97  
:BLT:SWISS 3->82 Y4036_STRCO 3e-07 31.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54801.1 GT:GENE AAZ54801.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 905226..905519 GB:FROM 905226 GB:TO 905519 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54801.1 GB:DB_XREF GI:71914899 LENGTH 97 SQ:AASEQ MGIRHIALFRWNDTVTPDQVEQVITALSKLPAAIPELKNYAFGADLGLAAGNYDFAVVADLDGEDGFRAYQDHPDHRAALAIIAPMLADRVAVQFAL GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 3->82|Y4036_STRCO|3e-07|31.2|80/97| BL:PDB:NREP 1 BL:PDB:REP 2->97|3bguB|8e-51|100.0|95/102| RP:PDB:NREP 1 RP:PDB:REP 1->97|3bguB|1e-21|99.0|96/102| RP:PFM:NREP 1 RP:PFM:REP 3->95|PF07876|1e-12|33.7|92/97|Dabb| HM:PFM:NREP 1 HM:PFM:REP 3->95|PF07876|1.3e-22|33.3|93/97|Dabb| RP:SCP:NREP 1 RP:SCP:REP 3->94|1x8dA1|1e-04|10.2|88/104|d.58.4.21| HM:SCP:REP 3->98|1tr0A_|9.8e-23|33.3|96/106|d.58.4.4|1/1|Dimeric alpha+beta barrel| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------1------------2-------------------------------1------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEcTTccHHHHHHHHHHHHTHHHHcTTccEEEEEEcccccTTcccEEEEEEEEHHHHHHHHHHcHHHHHHHHHHGGGEEEEEEEEEEc PSIPRED ccEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEEEEccHHHHHHHccccHHHHHHHHHHHHHHcEEEEEEEc //