[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54815.1
DDBJ      :             similar to nucleic-acid-binding protein implicated in transcription termination
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.192.1
:93 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  14->78 1g2rA  d.192.1.1 * 1e-14 27.7 %
:HMM:SCOP  11->83 1g2rA_ d.192.1.1 * 1.3e-14 31.5 %
:RPS:PFM   16->78 PF04296 * DUF448 1e-10 44.4 %
:HMM:PFM   16->78 PF04296 * DUF448 1.4e-22 47.6 63/78  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54815.1 GT:GENE AAZ54815.1 GT:PRODUCT similar to nucleic-acid-binding protein implicated in transcription termination GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 918870..919151 GB:FROM 918870 GB:TO 919151 GB:DIRECTION + GB:PRODUCT similar to nucleic-acid-binding protein implicated in transcription termination GB:PROTEIN_ID AAZ54815.1 GB:DB_XREF GI:71914913 LENGTH 93 SQ:AASEQ MSPRGRMGDNSAAPVRTCVGCKSKAAQSDLIRLALDGDAVVCDHARRLPGRGAYLHPDRRCWEAAQRRQVWPRVFRVKRALDISPAAEWFAAV GT:EXON 1|1-93:0| RP:PFM:NREP 1 RP:PFM:REP 16->78|PF04296|1e-10|44.4|63/78|DUF448| HM:PFM:NREP 1 HM:PFM:REP 16->78|PF04296|1.4e-22|47.6|63/78|DUF448| RP:SCP:NREP 1 RP:SCP:REP 14->78|1g2rA|1e-14|27.7|65/94|d.192.1.1| HM:SCP:REP 11->83|1g2rA_|1.3e-14|31.5|73/94|d.192.1.1|1/1|YlxR-like| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ----11---------------1--11------1111-111--11---1---11-1-11--111--1-1111----------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14| PSIPRED ccccccccccccccEEEEEcccccccHHHEEEEEEcccEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcc //