[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54828.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->116 PF04020 * DUF360 2e-04 33.0 %
:HMM:PFM   1->116 PF04020 * DUF360 3e-29 43.9 107/108  
:BLT:SWISS 2->124 Y3922_STRCO 2e-13 30.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54828.1 GT:GENE AAZ54828.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 934219..934596 GB:FROM 934219 GB:TO 934596 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ54828.1 GB:DB_XREF GI:71914926 LENGTH 125 SQ:AASEQ MSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVGCIFYYVTLGLVALVVNALLLWLTAWLAGVLGIPFEIDGFWAAFWGAIIVAIVSWLLSLFVGKDDD GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 2->124|Y3922_STRCO|2e-13|30.1|123/100| TM:NTM 4 TM:REGION 3->25| TM:REGION 33->55| TM:REGION 67->89| TM:REGION 100->122| SEG 66->90|vtlglvalvvnalllwltawlagvl| RP:PFM:NREP 1 RP:PFM:REP 1->116|PF04020|2e-04|33.0|106/106|DUF360| HM:PFM:NREP 1 HM:PFM:REP 1->116|PF04020|3e-29|43.9|107/108|DUF360| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1---------1-11---------11--1--1111---------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 123-125| PSIPRED cHHHHHHHHHHHHHHHHHHHHccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHccccc //