[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54832.1
DDBJ      :             helix-turn-helix motif
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->99 2ao9D PDBj 8e-08 7.6 %
:RPS:SCOP  7->81 1y7yA1  a.35.1.3 * 1e-07 18.8 %
:HMM:SCOP  9->92 1y9qA1 a.35.1.8 * 5.4e-06 20.3 %
:HMM:PFM   21->54 PF01381 * HTH_3 3.6e-06 23.5 34/55  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54832.1 GT:GENE AAZ54832.1 GT:PRODUCT helix-turn-helix motif GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 940041..940781 GB:FROM 940041 GB:TO 940781 GB:DIRECTION + GB:PRODUCT helix-turn-helix motif GB:PROTEIN_ID AAZ54832.1 GB:DB_XREF GI:71914930 InterPro:IPR001387 LENGTH 246 SQ:AASEQ MRQECSNEEQDQSAAPVGRELAAARARRGYTLRQLSELTRIPESVLHAWEHGDTACGPAERYRAQVRTLCAVLDLDPAALLCRGDPGQAPVRRRTAPSRGGQWGWAAVVIAAALTLAVLAWPGRPFTPDHPEAFPAAGQSPAGSPSAPDPASSAAPAVPPTAGQVTLRVTAHRPTWVSVTDGTDMLFTGVLAAGQTRDWTADEVIHLRLADAGGVHLWVNGHAYGVPGADGEVTHLTYTAQSGSPR GT:EXON 1|1-246:0| TM:NTM 1 TM:REGION 104->123| SEG 22->28|aaararr| SEG 106->120|aavviaaaltlavla| SEG 133->163|afpaagqspagspsapdpassaapavpptag| RP:PDB:NREP 1 RP:PDB:REP 17->99|2ao9D|8e-08|7.6|79/107| HM:PFM:NREP 1 HM:PFM:REP 21->54|PF01381|3.6e-06|23.5|34/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 7->81|1y7yA1|1e-07|18.8|69/69|a.35.1.3| HM:SCP:REP 9->92|1y9qA1|5.4e-06|20.3|79/0|a.35.1.8|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 99 STR:RPRED 40.2 SQ:SECSTR HHTTccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHTccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHcccccHHHHHH################################################################################################################################################### DISOP:02AL 1-17, 83-100, 121-167, 241-246| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEEEEEEccHHHHHHHcccccEEEEEcccEEEEEEccccEEEEEEccEEEccccccccEEEEEEcccccccc //