[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54837.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  320/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:155 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->153 2z90B PDBj 1e-29 44.4 %
:RPS:PDB   13->153 2chpC PDBj 2e-20 23.6 %
:RPS:SCOP  10->154 2fjcA1  a.25.1.1 * 4e-32 22.1 %
:HMM:SCOP  1->156 1dpsA_ a.25.1.1 * 1.8e-41 37.7 %
:RPS:PFM   38->153 PF00210 * Ferritin 2e-09 37.7 %
:HMM:PFM   19->154 PF00210 * Ferritin 4.5e-20 19.7 132/142  
:BLT:SWISS 8->153 DPS_MYCSM 3e-18 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54837.1 GT:GENE AAZ54837.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 944112..944579 GB:FROM 944112 GB:TO 944579 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54837.1 GB:DB_XREF GI:71914935 InterPro:IPR002177 LENGTH 155 SQ:AASEQ MAKIHSALSEEARKSVGQTLQAAIVDLIDLTLLGKQAHWNVIGRNFRSIHLQLDELVEAARKHTDTLAERAIALGVNPDGRVSRIAQDTRLPQLDPGYIQDDKVVAFVVEALSGAVDRFREHVKATEETDPITQDLLIAAAQDLEQQHWMFQAMS GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 8->153|DPS_MYCSM|3e-18|35.0|143/183| BL:PDB:NREP 1 BL:PDB:REP 12->153|2z90B|1e-29|44.4|142/160| RP:PDB:NREP 1 RP:PDB:REP 13->153|2chpC|2e-20|23.6|140/145| RP:PFM:NREP 1 RP:PFM:REP 38->153|PF00210|2e-09|37.7|106/141|Ferritin| HM:PFM:NREP 1 HM:PFM:REP 19->154|PF00210|4.5e-20|19.7|132/142|Ferritin| GO:PFM:NREP 2 GO:PFM GO:0006879|"GO:cellular iron ion homeostasis"|PF00210|IPR008331| GO:PFM GO:0008199|"GO:ferric iron binding"|PF00210|IPR008331| RP:SCP:NREP 1 RP:SCP:REP 10->154|2fjcA1|4e-32|22.1|145/151|a.25.1.1| HM:SCP:REP 1->156|1dpsA_|1.8e-41|37.7|154/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 352 OP:NHOMOORG 320 OP:PATTERN -------------------------------------------------------------------- -1----11111-1-221----2---2------222221221111212-12211221111111-11112211-111111----------------------1--11--1-1--------------------------111--------111--111--------11-1122-------------112-----1------------------111------------111111---11111111111111111112-------1-11111--------------1111111---1---111-111111111111111----111-------------------------1-------------------------1-1---------1-112----1---1111111111----1-1123--1-111----121-------1------2--11111111-1111-1------------------------------------1----111111111111111111111-11--------------------11--1---1-------------------------------------11112---------------------------------2---1-1----------------------1----------11-11111111111111-1111111111111111111111111-21111111111111111111111111-111111111111------------------1111-11--------------1---------1-1--1111-111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHGE PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //