[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54850.1
DDBJ      :             ABC-type antimicrobial peptide transport system ATPase component
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  906/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:209 amino acids
:PSIPRED
:BLT:PDB   1->200 3dhwC PDBj 5e-29 36.7 %
:RPS:PDB   2->208 2dwoA PDBj 1e-36 9.4 %
:RPS:SCOP  1->207 1b0uA  c.37.1.12 * 7e-37 29.0 %
:HMM:SCOP  4->207 1ii8.1 c.37.1.12 * 2.3e-60 35.0 %
:RPS:PFM   41->159 PF00005 * ABC_tran 7e-13 37.5 %
:HMM:PFM   41->159 PF00005 * ABC_tran 1.7e-26 41.7 115/118  
:HMM:PFM   12->47 PF03193 * DUF258 2.6e-05 31.4 35/161  
:BLT:SWISS 1->205 MACB_CAMJR 8e-33 35.6 %
:PROS 132->146|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54850.1 GT:GENE AAZ54850.1 GT:PRODUCT ABC-type antimicrobial peptide transport system ATPase component GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(959602..960231) GB:FROM 959602 GB:TO 960231 GB:DIRECTION - GB:PRODUCT ABC-type antimicrobial peptide transport system ATPase component GB:PROTEIN_ID AAZ54850.1 GB:DB_XREF GI:71914948 InterPro:IPR001687 InterPro:IPR003439 InterPro:IPR003593 LENGTH 209 SQ:AASEQ MITVKNLTKSFGTRTLWRNLNLTVPAGRMLALVGASGSGKTTLLNCIGLLERPSSGHILFDNTDLTRLGPGGRRRFRRDKLGYLFQDYALIDNATVKANLDVARRRGTRPDYARILERVGLAGRENEKVHYLSGGEQQRVALARLMVKQPTLVLADEPTGALDSANSAMVVNVLREMSEQGCAVVIATHNDGVRDACDLVFDVHEQREL GT:EXON 1|1-209:0| BL:SWS:NREP 1 BL:SWS:REP 1->205|MACB_CAMJR|8e-33|35.6|205/641| PROS 132->146|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 65->84|ltrlgpggrrrfrrdklgyl| BL:PDB:NREP 1 BL:PDB:REP 1->200|3dhwC|5e-29|36.7|199/343| RP:PDB:NREP 1 RP:PDB:REP 2->208|2dwoA|1e-36|9.4|192/449| RP:PFM:NREP 1 RP:PFM:REP 41->159|PF00005|7e-13|37.5|112/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->159|PF00005|1.7e-26|41.7|115/118|ABC_tran| HM:PFM:REP 12->47|PF03193|2.6e-05|31.4|35/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->207|1b0uA|7e-37|29.0|207/258|c.37.1.12| HM:SCP:REP 4->207|1ii8.1|2.3e-60|35.0|203/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 31051 OP:NHOMOORG 1166 OP:PATTERN DD75FB87EEFDDCEAQ9CCC99OaDGKaBMAD5A888CDEC7JPFMQFJiYP7BLEEHAAB95J186 CNVK*QMNSSWJIFNJJFF-FS66M*FFFFFFdYZZdu**JmRydlTRaTODjmeFMS77aZaSncj***RPPNNoNNPIkUW7676ALLLE2DBE8--8CLEAEPBNDE55555555967777AMGHFKCCFKLHSSThoCB8fQTIQVGGOLOLMDAA8DBJLLRZdbHBF8BA7AI9CAATRTCCPK8JOjopsorow*hxyvqr**fccdf*t*UVYxiTUcbdZYa**MXYYXYUTVVXXXVULQPMOfOLRifRJQHOWWIJglJLHKZRQQNXVXVXTcUZYXaZbVXabVZXKJIIIKMLKLLJJZUUQOQVUWUXscruuwu*yzzUpUVuqqPRRQuVUWelUZJF**PVMOTSHMPPROCMNOHMOMMHEDEDESM***RKb**w*qtywywr*stu*-bf*XW*cr**G7**************CBIl***t***p*KJKKKKKKdRTFIZLn55533333333354334544435556373EA9BB8p**p*******soopk****xrwxXs***so*qAGihbjUZTZxj****MVVHMFGdMEFEEEEEJMHLVURh*HUPfbKZcUScCVQSJLRVPNPPMOehOmGGEGBECDDCE798899899AE88CCBbZhIiNQBIFiKOPQOCKSNMMLJNQMNNP5-7BOHF1--111qh**Qphhlljhkimbg-kggehflehflnieegede*****TRTabZZbabaaaZZaZZa*aXWbbZfQ2sxyz*zztw***33CDAC9ABFEFFIBob*PPNUSPCJNJJKJOQIKMKKDMCGKfTddcdm*x*fprhjV***B9B9ACAB9EPUUcdeeeejjdbaKKHFGFFDEF878733DLFFDDBC77665666k8I75752-3264745HGD56B671334JTRFGPfPSO9RI --11DH3-A61569B86581868A7986633337775545455233678A98C857935545123242-2223221311251112113-111622-222243233314AC6C969F944514B4GI3H3P*G-E7A7273B76GA46732G22M3668M39E3C4F4OHGjDOE35522D34348LD9a6BE46KAEF5 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHcccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEc //