[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54854.1
DDBJ      :             diaminopimelate epimerase
Swiss-Prot:DAPF_THEFY   RecName: Full=Diaminopimelate epimerase;         Short=DAP epimerase;         EC=5.1.1.7;

Homologs  Archaea  21/68 : Bacteria  652/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->268 3fveA PDBj 7e-53 51.0 %
:RPS:PDB   1->270 1bwzA PDBj 7e-40 29.1 %
:RPS:SCOP  1->132 1bwzA1  d.21.1.1 * 2e-22 33.3 %
:RPS:SCOP  142->270 1bwzA2  d.21.1.1 * 1e-24 28.7 %
:HMM:SCOP  1->136 1bwzA1 d.21.1.1 * 4e-35 50.0 %
:HMM:SCOP  144->270 1bwzA2 d.21.1.1 * 7.7e-25 38.6 %
:RPS:PFM   5->136 PF01678 * DAP_epimerase 8e-15 48.3 %
:HMM:PFM   3->135 PF01678 * DAP_epimerase 8.5e-37 44.5 119/121  
:HMM:PFM   153->262 PF01678 * DAP_epimerase 3.4e-19 29.8 104/121  
:BLT:SWISS 1->274 DAPF_THEFY e-154 100.0 %
:PROS 76->90|PS01326|DAP_EPIMERASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54854.1 GT:GENE AAZ54854.1 GT:PRODUCT diaminopimelate epimerase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 964712..965536 GB:FROM 964712 GB:TO 965536 GB:DIRECTION + GB:PRODUCT diaminopimelate epimerase GB:PROTEIN_ID AAZ54854.1 GB:DB_XREF GI:71914952 InterPro:IPR001653 LENGTH 274 SQ:AASEQ MRFAKGHGTENDFVILPDPDGELDLDAATVAALCDRRAGLGADGVLRVVRTKALDEPLTGEAATAQRCEWFMDYRNADGSVAEMCGNGVRVFARYLQEAGLVGAAAFEVGTRAGARHVVLEPDGNITVDMGPVRILGPGSARLADGPVHGTRISVGNPHLACRVARPVAEVDLSAPPLLRAEEFPQGANVEVFREVASGVLEMRVYERGAAETRSCGTGIVAAAAAATPPGEDARWTVRVPGGECTVVLESGAARLSGPAVIVAEGDVRLSALR GT:EXON 1|1-274:0| SW:ID DAPF_THEFY SW:DE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase; EC=5.1.1.7; SW:GN Name=dapF; OrderedLocusNames=Tfu_0816; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm; Isomerase;Lysine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|DAPF_THEFY|e-154|100.0|274/274| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 76->90|PS01326|DAP_EPIMERASE|PDOC01029| SEG 222->227|aaaaaa| BL:PDB:NREP 1 BL:PDB:REP 1->268|3fveA|7e-53|51.0|259/283| RP:PDB:NREP 1 RP:PDB:REP 1->270|1bwzA|7e-40|29.1|258/274| RP:PFM:NREP 1 RP:PFM:REP 5->136|PF01678|8e-15|48.3|118/120|DAP_epimerase| HM:PFM:NREP 2 HM:PFM:REP 3->135|PF01678|8.5e-37|44.5|119/121|DAP_epimerase| HM:PFM:REP 153->262|PF01678|3.4e-19|29.8|104/121|DAP_epimerase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF01678|IPR001653| GO:PFM GO:0008837|"GO:diaminopimelate epimerase activity"|PF01678|IPR001653| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01678|IPR001653| RP:SCP:NREP 2 RP:SCP:REP 1->132|1bwzA1|2e-22|33.3|120/130|d.21.1.1| RP:SCP:REP 142->270|1bwzA2|1e-24|28.7|129/144|d.21.1.1| HM:SCP:REP 1->136|1bwzA1|4e-35|50.0|124/0|d.21.1.1|1/2|Diaminopimelate epimerase-like| HM:SCP:REP 144->270|1bwzA2|7.7e-25|38.6|127/0|d.21.1.1|2/2|Diaminopimelate epimerase-like| OP:NHOMO 719 OP:NHOMOORG 695 OP:PATTERN -----------------------1----1-1-11111111111111111----1-------------- 1111111111111-11111-111111111111111111111111111-1111111111--111111121111111111----111111111111--1--11111111111--------------111111111111-----111--111111111111111111111221111111111-111-----1111-1111111111111111111111111111-1--11111111-----------------------------------11-1---------------------------------------------------111-11111111111-11111112-1--1111111111-11111111--111-111111-1------1---1---11111111111-1--1-1---11-111-1211111-1----1111111111111111111111111111-1-111----------------------1-111111111112111111111111-11111111111111111111111111111111111111111111111111111111111-11-1111111111111111211111-1-111--1-------11111111111111111111111111111111111111--11111-----11111111111111111-1111111111111111111121111111111111111111111111111111-11111111111111111111111111111211111111111111111111111111111111111121211111---------11111111111111111111111111111111-111111------------------------------------11-1-11111111 ------1-----------------------------------------------------------------------------------------------------1-------------------------------------------------2----11---------21111811111---2-1211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 98.5 SQ:SECSTR cEEEEEEETTEEEEEEETTcccccccHHHHHHHHcTTTcccccEEEEEEcccTHHHHEEEEEcccTTccEEEEEEETTccccccTTTTHHHHHHHHHHTTcccccEEEEEccccEEEEEEcTTccEEEEcccccccccEEEEETTEEEEEEEEEcccEEEEEEcccTTTccHHHHHHHHHTTTcTTccEEEEEEEEETTEEEEEEEETTTEEccccHHHHHHHHHHHHHTTccccEEEEccccEEEcccTTcccEEEEccEEEEEEEccc#### DISOP:02AL 274-275| PSIPRED cEEEEEccccccEEEEccccccccccHHHHHHHHcccccccccEEEEEEccccccccccccccccccccEEEEEEEccccHHHHcHHHHHHHHHHHHHcccccccEEEEEccccEEEEEEEccccEEEEccccccccccccEEccEEEEEEEEEccccEEEEEEccccccHHHHHHHHHcccccccccEEEEEEEEcccEEEEEEEEcccccccccHHHHHHHHHHHHHccccccEEEEEcccEEEEEEEccEEEEEEcEEEEEEEEEcHHHcc //