[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54863.1
DDBJ      :             ComEC/Rec2-related protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  252/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:784 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  629->771 1wraA1  d.157.1.8 * 3e-10 11.9 %
:HMM:SCOP  525->776 2bibA2 d.157.1.8 * 8e-31 28.3 %
:RPS:PFM   235->417 PF03772 * Competence 5e-18 39.8 %
:HMM:PFM   235->497 PF03772 * Competence 5.9e-52 35.7 263/271  
:HMM:PFM   546->679 PF00753 * Lactamase_B 2.2e-11 22.5 120/194  
:BLT:SWISS 222->417,629->765 COMEC_BACSU 2e-10 33.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54863.1 GT:GENE AAZ54863.1 GT:PRODUCT ComEC/Rec2-related protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(976131..978485) GB:FROM 976131 GB:TO 978485 GB:DIRECTION - GB:PRODUCT ComEC/Rec2-related protein GB:PROTEIN_ID AAZ54863.1 GB:DB_XREF GI:71914961 InterPro:IPR004477 LENGTH 784 SQ:AASEQ MTAAGSGPLPGAGVRLDVSLAVPAVGLWLTVLALLHAAPRTAFLTAAVLGTAAWAGLLLLRHPRWGTVAALCGATLVCAAGGAVAVAGRTAAVAASPMAELAAAQQFTEASVVLALDPRPRENPAVPGRAEFVVTAHTEWVTLPDGTRVRSRVPVVLLVHGEQWRHLVPSQPVRVAGTAVPAGTRLDAALLLVRGPPRHVGPPSAAHAWADRVRGGLRRACAVLPQPERGLLPALVVGDTSLLDAETAEIFRATGMTHLLTVSGANLAVMTGAVLAVTRWLRLPVWASALTGAATIAGFVLLARPEPSVLRAAFMGAVALVSLVVGRPRIGVAALAAAVIGLLLFHPALAASFGFALSVLATGGIMVLAPPWRDAWARRVPAWLAEPVAVTLAAQVACAPLLVVLSAEVSWVSVPTNVAAGPFVPVATVGGFVVAALGLVAPPAAQVAVWVPGVAVAWIHRIAEWGARVPHGAVPWRSDVVGALLLAVLLAALLVLRGWARRVVAAGIAASAVAALALACLAPSWPPPRWAVVACDVGQGDALVLAVDRGEAVVVDTGPRPGAVDRCLDRLRVRRVALLVLTHHDLDHAGGTSGVLRGRTVAEAVVPPGFDAPDAAAALERAGARLRTVHAGEELAVGRWRLSVLWPPADFAGGDANEGSVVVLAHRSAAPPAEGGLSVLLTGDIEESAQRALLTHPGIRGVDVLKTPHHGAGTQEAVFLEATRPRVTLTSVGAGNPYGHPAADTWAQLTALTSASYRTDQHGDVAVVPTGDGPVVYWRGPDVR GT:EXON 1|1-784:0| BL:SWS:NREP 1 BL:SWS:REP 222->417,629->765|COMEC_BACSU|2e-10|33.6|319/776| TM:NTM 10 TM:REGION 16->38| TM:REGION 40->61| TM:REGION 73->95| TM:REGION 259->281| TM:REGION 294->316| TM:REGION 340->362| TM:REGION 384->406| TM:REGION 429->451| TM:REGION 472->494| TM:REGION 503->522| SEG 44->60|ltaavlgtaawagllll| SEG 68->95|vaalcgatlvcaaggavavagrtaavaa| SEG 148->159|rvrsrvpvvllv| SEG 330->344|igvaalaaaviglll| SEG 418->457|vaagpfvpvatvggfvvaalglvappaaqvavwvpgvava| SEG 480->522|vvgalllavllaallvlrgwarrvvaagiaasavaalalacla| SEG 563->581|avdrcldrlrvrrvallvl| SEG 604->627|avvppgfdapdaaaaleragarlr| RP:PFM:NREP 1 RP:PFM:REP 235->417|PF03772|5e-18|39.8|181/271|Competence| HM:PFM:NREP 2 HM:PFM:REP 235->497|PF03772|5.9e-52|35.7|263/271|Competence| HM:PFM:REP 546->679|PF00753|2.2e-11|22.5|120/194|Lactamase_B| RP:SCP:NREP 1 RP:SCP:REP 629->771|1wraA1|3e-10|11.9|143/305|d.157.1.8| HM:SCP:REP 525->776|2bibA2|8e-31|28.3|244/0|d.157.1.8|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 298 OP:NHOMOORG 258 OP:PATTERN ------------------------111------------------11--------------------- 1-1-2-11---11111-11-11--1111111111111111111111-111--11111---111111111111---1111-112--------1-1------------11-1---------------1-----------111211122--1111------1111--1--111--1-----1----11-11----1122222112-22211212111-121211111-12212111----------------------1-11-1-------11------------1111--------------111111111-111-11---111-12-12-------1-3-1111---221--11--2222211-21222221--1-1-11-------------------------------------------------1-------1---------1----------------------------------------------------------111111-111111--111111-1--111--111-----1--11-1---111----------1--11----------1-----1-1-111-----21-1-----------------------------------1--------------1--1----------------------------------------------------------------------------------------------------------------1-1----------------------------------1-1--1-----1--------------------------------------------------------------------------------------1---------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 117-119, 121-124, 782-784| PSIPRED cccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccEEEEEEEEcccccccccccccccEEEEEEEccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHEEEEccEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEEEcccEEEEEEccccHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHccccEEEEccccccHHHHHHHHHccccEEEEccccEEEEccEEEEEEEcccccccccccccEEEEEEEEcEEEEEEcccEEEEEccccHHHHHHHHHccccccccEEEEcccccccccHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHcccEEEEcccccEEEEEEcccEEEEEEEccccc //