[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54876.1
DDBJ      :             heat-inducible transcription repressor HrcA
Swiss-Prot:HRCA_THEFY   RecName: Full=Heat-inducible transcription repressor hrcA;

Homologs  Archaea  0/68 : Bacteria  571/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.110.2
:343 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->312 1stzA PDBj 8e-29 32.1 %
:RPS:PDB   8->80 1biaA PDBj 9e-10 19.7 %
:RPS:SCOP  8->80 1hqcA1  a.4.5.11 * 2e-18 31.3 %
:RPS:SCOP  97->340 1stzA2  d.110.2.3 * 5e-49 22.1 %
:HMM:SCOP  7->93 1stzA1 a.4.5.51 * 6.2e-26 48.3 %
:HMM:SCOP  77->344 1stzA2 d.110.2.3 * 1.4e-55 39.7 %
:RPS:PFM   7->82 PF03444 * DUF293 9e-18 65.8 %
:RPS:PFM   108->322 PF01628 * HrcA 3e-32 39.5 %
:HMM:PFM   108->326 PF01628 * HrcA 5.9e-59 37.0 219/224  
:HMM:PFM   14->79 PF03444 * DUF293 4.7e-08 31.2 64/79  
:BLT:SWISS 1->343 HRCA_THEFY 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54876.1 GT:GENE AAZ54876.1 GT:PRODUCT heat-inducible transcription repressor HrcA GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 993348..994379 GB:FROM 993348 GB:TO 994379 GB:DIRECTION + GB:PRODUCT heat-inducible transcription repressor HrcA GB:PROTEIN_ID AAZ54876.1 GB:DB_XREF GI:71914974 InterPro:IPR002571 LENGTH 343 SQ:AASEQ MLDDRNVLDDRKLAVLRAIVEDYVSTNEPVGSKALAERHKLGVSPATIRNDMVALEELGYIAQPHTSAGRVPTDKGYRLFVDRLSKVKPLSKAERRAIETFLSGALDLDEIVSRTVRLLAHLTRQVAIMQYPSLTRSSVQHLELVPLGPQRLMLVLITNTGRVEQRVIDGLAEVSDDVVENLRGALNRALVGKWLTEAPKEFPTVLAQLPLEERPIAESVMSVLTESLVEKHEGKVVFGGTANLAAMGFSAGLRDVLEALEENVVLIRLLGEMGDASMLTVRIGAENNHEGLQSTSIVAAGYGIGDQTLAKLGVVGPTRMDYPGTMGAVRAVARYVGQILAGQ GT:EXON 1|1-343:0| SW:ID HRCA_THEFY SW:DE RecName: Full=Heat-inducible transcription repressor hrcA; SW:GN Name=hrcA; OrderedLocusNames=Tfu_0838; SW:KW Complete proteome; Repressor; Stress response; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->343|HRCA_THEFY|0.0|100.0|343/343| GO:SWS:NREP 3 GO:SWS GO:0006950|"GO:response to stress"|Stress response| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 8->312|1stzA|8e-29|32.1|287/323| RP:PDB:NREP 1 RP:PDB:REP 8->80|1biaA|9e-10|19.7|66/292| RP:PFM:NREP 2 RP:PFM:REP 7->82|PF03444|9e-18|65.8|73/76|DUF293| RP:PFM:REP 108->322|PF01628|3e-32|39.5|215/224|HrcA| HM:PFM:NREP 2 HM:PFM:REP 108->326|PF01628|5.9e-59|37.0|219/224|HrcA| HM:PFM:REP 14->79|PF03444|4.7e-08|31.2|64/79|DUF293| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF03444|IPR005104| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03444|IPR005104| GO:PFM GO:0003677|"GO:DNA binding"|PF01628|IPR002571| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01628|IPR002571| RP:SCP:NREP 2 RP:SCP:REP 8->80|1hqcA1|2e-18|31.3|67/76|a.4.5.11| RP:SCP:REP 97->340|1stzA2|5e-49|22.1|226/236|d.110.2.3| HM:SCP:REP 7->93|1stzA1|6.2e-26|48.3|87/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 77->344|1stzA2|1.4e-55|39.7|234/236|d.110.2.3|1/1|GAF domain-like| OP:NHOMO 573 OP:NHOMOORG 572 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111111111111111-1111111--111111111111111111-1111-------------------------1-1111111111111111111111111111111111111111111111111111111111111-1-----1-------1111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-1111-1111111111111111111111111111-11111111111-11111111111111-1111111111111111111111111111------------------------------1111111111111111111111111111111-1111111111111111111111111111111-------111111-----111-1-111-111111111111111-1---------------------1-1-11---------------------------------1111--------------------------------------------------------------------------------------------1---------11--------------------------------------------------------1--------------11111111111111----111111----------111111-11111111111111111111111111111--- -----------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 85.7 SQ:SECSTR cccccccccHHHHHHHHHHTTcccccHccccHHHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHccccccGGccccEEEEEEccccEEEEEEEETTEEEEEEEEEccccccHHHHHH###HHHHHHTTc##########cHHHHHHTccGGGGccHHHHHHHHHHTcccccEEEEcHHHHHHcTTccHHHHHHHHTTcHHHHHHHccc#####ccEEEEGGGGccGGGTTEEEEEEEEEETTEEEEEE############################### DISOP:02AL 1-4, 90-103, 273-276| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccEEEEEcccccccEEEEEEEEEEcccEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcHHHccccccHHHHHHHHHHHHcHHHHHHHHHHcccccccEEEEccccccccccccEEEEEEEccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccc //