[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54881.1
DDBJ      :             putative protein kinase C inhibitor (HIT family
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  472/915 : Eukaryota  77/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->101 1xquB PDBj 9e-18 38.9 %
:RPS:SCOP  7->118 1av5A  d.13.1.1 * 5e-20 36.0 %
:HMM:SCOP  4->118 1rzyA_ d.13.1.1 * 2.3e-33 38.6 %
:RPS:PFM   18->100 PF01230 * HIT 1e-10 35.4 %
:HMM:PFM   16->111 PF01230 * HIT 4.8e-24 33.3 93/98  
:BLT:SWISS 4->118 YHIT_AQUAE 2e-18 38.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54881.1 GT:GENE AAZ54881.1 GT:PRODUCT putative protein kinase C inhibitor (HIT family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 997810..998166 GB:FROM 997810 GB:TO 998166 GB:DIRECTION + GB:PRODUCT putative protein kinase C inhibitor (HIT family GB:PROTEIN_ID AAZ54881.1 GB:DB_XREF GI:71914979 InterPro:IPR001310 LENGTH 118 SQ:AASEQ MTDRRSDCLFCKIVAGEVPADIVREGERTIAFRDINPQAPTHVLIIPRDHYPDMASAGAAGIGLLDEIAREAGEIARAEGIADSGYRMVFNTGPGAGQTIFHVHGHLLGGRGLEWPPG GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 4->118|YHIT_AQUAE|2e-18|38.3|115/121| SEG 67->82|eiareageiaraegia| SEG 102->113|hvhghllggrgl| BL:PDB:NREP 1 BL:PDB:REP 7->101|1xquB|9e-18|38.9|95/113| RP:PFM:NREP 1 RP:PFM:REP 18->100|PF01230|1e-10|35.4|82/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 16->111|PF01230|4.8e-24|33.3|93/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 7->118|1av5A|5e-20|36.0|111/113|d.13.1.1| HM:SCP:REP 4->118|1rzyA_|2.3e-33|38.6|114/0|d.13.1.1|1/1|HIT-like| OP:NHOMO 628 OP:NHOMOORG 558 OP:PATTERN ---1-----------11--------11--------111----------------------------1- 11--2-----------------------------------1---1-111111--------1-1-12111111111111-112111111--------------------1---------------1111111-1111-----111-111111111111111-1111111111-111-111-111-1-11--11-----------------------------1---------11-----------------------------------------------------1--11111111111-------------111---111-11111111111111111111111-11111--11111111111111111--111-----------------------------------------------------------------21--11-------------11111---1--------------------1---------112212111111111111111111111111111111---11111111111--111111111111111111-1-1111----1-----111111111111111--11111-----1-1-------1-111----1111-11111111111111111111111---1111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---111111111111111111111111111111----------1-11111-11-1111-111111111111-111111111111111111111111----1111111111-----------------------------1-----1-1--------111 11----1-3--------------------------------------------------------------------------------------------------23-421222-1-22-1-34-21273-22521-1312321112-2--2112111121211122311122-11------12123-232111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 94.9 SQ:SECSTR ######ccHHHHHHTTcccccEEEEcccEEEEEcccccccEEEEEEEccccccGGGccTTGGGHHHHHHHHHHHHHHHTTcTTTcEEEEccccTTTTcccccccEEEEEccccccccc DISOP:02AL 1-2, 117-118| PSIPRED cccccccccEEEEEccccccEEEEEccEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEEEcccccccccc //