[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54885.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  11->113 1mq0A_ c.97.1.1 * 5.8e-08 35.0 %
:HMM:PFM   47->120 PF01408 * GFO_IDH_MocA 0.00012 19.2 73/120  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54885.1 GT:GENE AAZ54885.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1001263..1001634 GB:FROM 1001263 GB:TO 1001634 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54885.1 GB:DB_XREF GI:71914983 InterPro:IPR010916 LENGTH 123 SQ:AASEQ MSNTAHELSNPEDTKLITLARSSRARNSAAEGAAVRDETGRTYVATTVSLPSLQLSAVQAAVAAAVSSGAQRLEAAVVVTEAAEWTEADRAVAADLNTETLVVAAPDGTPVRVEQGAAGRGNR GT:EXON 1|1-123:0| SEG 20->34|arssrarnsaaegaa| SEG 52->71|slqlsavqaavaaavssgaq| SEG 74->88|eaavvvteaaewtea| HM:PFM:NREP 1 HM:PFM:REP 47->120|PF01408|0.00012|19.2|73/120|GFO_IDH_MocA| HM:SCP:REP 11->113|1mq0A_|5.8e-08|35.0|103/130|c.97.1.1|1/1|Cytidine deaminase-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 116-123| PSIPRED cccHHHHHccccccEEEEEEEccccccccccccEEEEccccEEEEEEEEHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHccccEEEEEcccccEEEEEccccccccc //