[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54893.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.10
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->202 3dciA PDBj 5e-23 19.1 %
:RPS:SCOP  8->202 3bzwA1  c.23.10.9 * 7e-22 16.7 %
:HMM:SCOP  7->208 1vjgA_ c.23.10.6 * 2e-36 30.5 %
:RPS:PFM   14->195 PF00657 * Lipase_GDSL 9e-05 31.2 %
:HMM:PFM   13->196 PF00657 * Lipase_GDSL 4e-26 24.9 177/235  
:BLT:SWISS 11->195 LIPC_BACLD 2e-05 23.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54893.1 GT:GENE AAZ54893.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1009522..1010325 GB:FROM 1009522 GB:TO 1010325 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54893.1 GB:DB_XREF GI:71914991 InterPro:IPR001087 LENGTH 267 SQ:AASEQ MSGFTLGKDILSYVAVGDSFTEGLDDPYPDSARFPQGRYRGWADRFAEHLARHVREVRYANLAVRGKLLRQILTEQLPRAVELRPDLVTLCAGGNDILRPGSDPDTLADAFEGAVRQLRDTGADVVIFTGFDTGFQPVMRHLRGKIATYNMHLRGIADRYHCRVVDLWSMKIFQDRRAWSDDRLHLSAEGHRRLALRVCEVMGVPVDEDWNAPWPQEPPAPWHQARQEDLRWARQHLVPWIHRRLTGRSSGDGVRPKRPNLEPLVRR GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 11->195|LIPC_BACLD|2e-05|23.6|178/100| RP:PDB:NREP 1 RP:PDB:REP 12->202|3dciA|5e-23|19.1|178/203| RP:PFM:NREP 1 RP:PFM:REP 14->195|PF00657|9e-05|31.2|170/201|Lipase_GDSL| HM:PFM:NREP 1 HM:PFM:REP 13->196|PF00657|4e-26|24.9|177/235|Lipase_GDSL| GO:PFM:NREP 2 GO:PFM GO:0006629|"GO:lipid metabolic process"|PF00657|IPR001087| GO:PFM GO:0016788|"GO:hydrolase activity, acting on ester bonds"|PF00657|IPR001087| RP:SCP:NREP 1 RP:SCP:REP 8->202|3bzwA1|7e-22|16.7|180/248|c.23.10.9| HM:SCP:REP 7->208|1vjgA_|2e-36|30.5|190/0|c.23.10.6|1/1|SGNH hydrolase| OP:NHOMO 86 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ----2----------11-----11-1------112121---231-1-21112545112--221-2233223---------------------------------------------------------------------------------------------------------------------------11111111-111111------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 79.4 SQ:SECSTR #######HTTcEEEEEEcHHHHTccTTTcccccGGGc#TccHHHHHHHHHTTHHTcEEEEEEEcTTcccccccHHHHHHHHHHHcccEEEEccTTTTcGGGTHHHHHHHHHHHcccccTTcccEEEEEEcccTTcccGcGGccHHHHTHHHHHHHHHHHHTcEEEEGGGTcccGGEEEcTTTcccccHHHHHHHHHHHHHHH###HHHHTcGGGGGccccccc############################################ DISOP:02AL 266-267| PSIPRED ccccccccccEEEEEEEcHHHcccccccccccccccccccccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHcccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccHHHcccHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //