[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54894.1
DDBJ      :             zinc uptake regulator, Fur family
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  636/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->122 2o03A PDBj 1e-36 55.9 %
:RPS:PDB   4->121 1b4aA PDBj 1e-04 16.5 %
:RPS:SCOP  4->119 1mzbA  a.4.5.42 * 4e-21 33.0 %
:HMM:SCOP  1->121 1mzbA_ a.4.5.42 * 1.1e-29 42.5 %
:RPS:PFM   1->115 PF01475 * FUR 1e-21 39.5 %
:HMM:PFM   2->115 PF01475 * FUR 5.4e-32 37.2 113/120  
:BLT:SWISS 20->128 FUR_NEIMC 9e-19 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54894.1 GT:GENE AAZ54894.1 GT:PRODUCT zinc uptake regulator, Fur family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1010338..1010727) GB:FROM 1010338 GB:TO 1010727 GB:DIRECTION - GB:PRODUCT zinc uptake regulator, Fur family GB:PROTEIN_ID AAZ54894.1 GB:DB_XREF GI:71914992 InterPro:IPR002481 LENGTH 129 SQ:AASEQ MSSRREAVRQALHKSNGFRSAQDLYASLRADGAKIGLTTVYRALQALTDAGEVDVLMTDEGEAVYRACSTPTHHHHLVCRDCGKAVEIEGPAVESWADELAAQHGFVDLTHTLELFGTCSDCAAAKPRT GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 20->128|FUR_NEIMC|9e-19|37.0|108/144| BL:PDB:NREP 1 BL:PDB:REP 4->122|2o03A|1e-36|55.9|118/129| RP:PDB:NREP 1 RP:PDB:REP 4->121|1b4aA|1e-04|16.5|115/146| RP:PFM:NREP 1 RP:PFM:REP 1->115|PF01475|1e-21|39.5|114/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 2->115|PF01475|5.4e-32|37.2|113/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 4->119|1mzbA|4e-21|33.0|115/133|a.4.5.42| HM:SCP:REP 1->121|1mzbA_|1.1e-29|42.5|120/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 869 OP:NHOMOORG 639 OP:PATTERN --------------------------------------------------1----------------- -2--111111111111211-11111111111111111111132221111111111111--2421211221111112111111221222--------------------1----------------1--2111-212211213341-8213111222231122121222222222111111121-111111-123333333333333333223323333333322322222225122222222222222233223----------11----1----------------------------------------------------12-21111111121211331111121212-12-2232-123212221---1-----1--------11--1-----11111111111-------------211111111111---1-11-111111111111111----1---------------------------------11--112211111111211111112111111111222211222111114111121111-1111111111111111111211--31232211313223211222212--21211111111111111111-1-11111231-1111111122112111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1-1111111-11112111111111111111111111111111211111--12111-2-1-111111111-111111111111111111111111----111----1------------1--------------------------1---11111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 95.3 SQ:SECSTR ccHHHHHHHHHHHHHcccccHHHHHHHHHHTTccccHHHHHHHHHHTHTTcEEEEcccccEEEEcTTcccccHHHHHHHHHHHHEEEEEEETTEEEEEEcHHHHHHHHHHHTTTEEEEEEcTH###### DISOP:02AL 124-129| PSIPRED ccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEccccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHcccccc //