[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54917.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->59 PF11808 * DUF3329 0.00019 28.6 35/90  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54917.1 GT:GENE AAZ54917.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1037811..1038188) GB:FROM 1037811 GB:TO 1038188 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54917.1 GB:DB_XREF GI:71915015 LENGTH 125 SQ:AASEQ MAHRRPNTVTAPTPIPKGVVFGIFLAVPSLMYGWVYFGHLWWAVAAGLVLVLGFGLTLLPRHLPRFSRGQQKVELYGGPLDGEHIDLSALSVERLSEGITLPVRGGGRCRYALDRSGVLRHVGDG GT:EXON 1|1-125:0| TM:NTM 2 TM:REGION 13->35| TM:REGION 40->62| SEG 40->59|lwwavaaglvlvlgfgltll| HM:PFM:NREP 1 HM:PFM:REP 24->59|PF11808|0.00019|28.6|35/90|DUF3329| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 123-125| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccEEcHHHHHHHHHHcccEEEEccccEEEEEEccccHHHccccc //