[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54930.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   72->149 PF07274 * DUF1440 6.8e-07 23.4 77/136  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54930.1 GT:GENE AAZ54930.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1052399..1052878 GB:FROM 1052399 GB:TO 1052878 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54930.1 GB:DB_XREF GI:71915028 LENGTH 159 SQ:AASEQ MEWHWAREEGTVGIVRAAAQGAVAGFAATGAMSGLLAAAYRRGKDPLLPPKLVTRRLLPGGRERTPRPGENAVTVLAHAGFGVAAGAVFGAATGERSPGLVAGACYGLLVWLLSYEGWVPRLTVQPPAHRDNPKRAVTMVVAHLVYGAALAAALRRMRR GT:EXON 1|1-159:0| TM:NTM 3 TM:REGION 15->37| TM:REGION 99->120| TM:REGION 136->154| SEG 12->31|vgivraaaqgavagfaatga| SEG 79->92|agfgvaagavfgaa| SEG 148->158|aalaaalrrmr| HM:PFM:NREP 1 HM:PFM:REP 72->149|PF07274|6.8e-07|23.4|77/136|DUF1440| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 62-64| PSIPRED cccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccEEEEEEccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //