[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54943.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.134.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->95 1uanB PDBj 1e-06 37.7 %
:RPS:PDB   29->70 3dfiA PDBj 4e-07 33.3 %
:RPS:SCOP  30->202 1uanA  c.134.1.1 * 2e-16 23.2 %
:HMM:SCOP  28->202 1uanA_ c.134.1.1 * 1.8e-27 31.4 %
:RPS:PFM   32->104 PF02585 * PIG-L 1e-07 42.3 %
:HMM:PFM   32->152 PF02585 * PIG-L 2.3e-17 33.1 118/128  
:BLT:SWISS 44->100 AZOR_FRASN 9e-04 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54943.1 GT:GENE AAZ54943.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1066618..1067328 GB:FROM 1066618 GB:TO 1067328 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54943.1 GB:DB_XREF GI:71915041 InterPro:IPR000169 LENGTH 236 SQ:AASEQ MDRPGTSEASWRGWPALREFPAVHLAGITSAVVIAAHPGDAVLSVGGTISMLAASGARVRMVSASTGDVADSGKRGTPWEWWGEVRHALQMLGADGVEIVQLRDSDGHGGGGGEPQAETLTRLCAGFDLCLAPWEGDRNPATEPVARAARQAAAALDIPVLGCPVWLWHWAHPEDPRVPWERMNRIVLSEEIRRLKVDAIACLNVWGGTSRVAADGMTLTTEKVAHFIRDAELVFR GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 44->100|AZOR_FRASN|9e-04|37.7|53/100| SEG 107->113|ghggggg| SEG 146->155|araarqaaaa| BL:PDB:NREP 1 BL:PDB:REP 32->95|1uanB|1e-06|37.7|61/219| RP:PDB:NREP 1 RP:PDB:REP 29->70|3dfiA|4e-07|33.3|42/242| RP:PFM:NREP 1 RP:PFM:REP 32->104|PF02585|1e-07|42.3|71/129|PIG-L| HM:PFM:NREP 1 HM:PFM:REP 32->152|PF02585|2.3e-17|33.1|118/128|PIG-L| RP:SCP:NREP 1 RP:SCP:REP 30->202|1uanA|2e-16|23.2|164/220|c.134.1.1| HM:SCP:REP 28->202|1uanA_|1.8e-27|31.4|169/227|c.134.1.1|1/1|LmbE-like| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1---11-------1----1--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------1112-111--111--------------------------11-1------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 27.5 SQ:SECSTR ############################cEEEEEEccTTHHHHHHHHHHHHHHHTTcEEEEEEccccccc##TccccHHHHHHHHHHHHHHHTcc############################################################################################################################################# DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccHHHEEEcccccccccccHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccEEEEccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccccEEEc //