[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54956.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->135 PF01966 * HD 4.9e-06 26.7 90/118  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54956.1 GT:GENE AAZ54956.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1081194..1081847 GB:FROM 1081194 GB:TO 1081847 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54956.1 GB:DB_XREF GI:71915054 LENGTH 217 SQ:AASEQ MARLLFELAGEWKRLAGPGREAAAVGAELLARWAEPHRRYHTLDHLKAVLAAVEVLADAARDSTLVRYAAWFHDAVYRGEPGADEENSAQLAELLLPSCGLSTEQVAEVARLVRVTADHSPEPGDANAEVLCDADLAILAAEDAEYTAYAAAVRQEYAHVGDVEFARGRIAVLRDLLASPRLYRTEQGYAWWEERARANVAAEIARLTEQAAGFAPS GT:EXON 1|1-217:0| SEG 46->60|lkavlaavevladaa| SEG 133->152|dadlailaaedaeytayaaa| HM:PFM:NREP 1 HM:PFM:REP 43->135|PF01966|4.9e-06|26.7|90/118|HD| OP:NHOMO 45 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------1-2-11---111111----1----1111-----------------------------------1------------------------------------------------------------111-------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------11-----------------------------1------------------1-----------------------------------------------------------------------1--------------------1--------1--1-1-1--1------------------------------------------1----1------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1-------------------------1------1-1------------------------------------------------------------------------------------------------------------ ----1--------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 215-217| PSIPRED ccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //