[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54957.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   64->88 PF01498 * Transposase_5 6.4e-06 48.0 25/72  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54957.1 GT:GENE AAZ54957.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1081812..1082087) GB:FROM 1081812 GB:TO 1082087 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ54957.1 GB:DB_XREF GI:71915055 LENGTH 91 SQ:AASEQ MSVLIDPPAWPGPRGLLWSHLVSDSSYAELHAFARALGIPERAFDRDHYDVPETLYAKALELGAIAVSSRTLVARLHAAGLRRRKPRRLLR GT:EXON 1|1-91:0| SEG 81->90|lrrrkprrll| HM:PFM:NREP 1 HM:PFM:REP 64->88|PF01498|6.4e-06|48.0|25/72|Transposase_5| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------------1111-11111111-----1----1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 86-91| PSIPRED cEEEcccccccccccHHHHHHHccccHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccc //