[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54983.1
DDBJ      :             CBS domain protein
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  178/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->123 1xkfB PDBj 2e-36 55.3 %
:RPS:PDB   2->126 3ctuB PDBj 3e-15 12.2 %
:RPS:SCOP  1->125 2o16A3  d.37.1.1 * 4e-20 22.0 %
:HMM:SCOP  2->65 1y5hA2 d.37.1.1 * 2.9e-13 42.2 %
:HMM:SCOP  64->123 1pbjA2 d.37.1.1 * 3.7e-09 28.3 %
:RPS:PFM   15->130 PF00478 * IMPDH 3e-05 30.2 %
:HMM:PFM   4->55 PF00571 * CBS 1.5e-15 38.5 52/57  
:HMM:PFM   78->124 PF00571 * CBS 4.1e-12 29.8 47/57  
:BLT:SWISS 1->120 YHCV_BACSU 3e-17 39.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54983.1 GT:GENE AAZ54983.1 GT:PRODUCT CBS domain protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1112390..1112824 GB:FROM 1112390 GB:TO 1112824 GB:DIRECTION + GB:PRODUCT CBS domain protein GB:PROTEIN_ID AAZ54983.1 GB:DB_XREF GI:71915081 InterPro:IPR000644 LENGTH 144 SQ:AASEQ MTTAKDIMHEGVQCIETNTNLVTAARMMRDLGVGALPICGEDNRLKGIITDRDIVVKCLAEGKDPNTCNAIELAEGTPFYVDASDDIETLLQEMTQHKVKRMPVIENKQLVGIVSEADLAQHLPEEELGRFVEAIKSGPPDHIV GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 1->120|YHCV_BACSU|3e-17|39.5|114/140| BL:PDB:NREP 1 BL:PDB:REP 1->123|1xkfB|2e-36|55.3|123/123| RP:PDB:NREP 1 RP:PDB:REP 2->126|3ctuB|3e-15|12.2|123/146| RP:PFM:NREP 1 RP:PFM:REP 15->130|PF00478|3e-05|30.2|106/459|IMPDH| HM:PFM:NREP 2 HM:PFM:REP 4->55|PF00571|1.5e-15|38.5|52/57|CBS| HM:PFM:REP 78->124|PF00571|4.1e-12|29.8|47/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 1->125|2o16A3|4e-20|22.0|123/130|d.37.1.1| HM:SCP:REP 2->65|1y5hA2|2.9e-13|42.2|64/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 64->123|1pbjA2|3.7e-09|28.3|60/61|d.37.1.1|2/2|CBS-domain| OP:NHOMO 283 OP:NHOMOORG 204 OP:PATTERN 33-21--1111111-1--------1--1---1--2-1------1--1---1111--------1----3 -11-2------------11-1-----11111-1---1----113--------11------11--1223-11------------------------------1---2---1--------------------------111------11-----2---------------1--------------11------122111111111111111-23312111122----------11-------------------------------------------------------------------------------------------11111111111-1-1---1----11--1--1---11--11-1--------1-1--1-----1-1------------------------------2---1---112---1111-------1-------------------2-------------------------------1---------3443431111144-42222--35-1111--------22-3123--1---------------11-1-1--------1--------------12-131-----------------------------1--------------------------------11-----------------------------------------------------------------------------------------------11111------1--------------11-------1-----21221---1-111-----------------1---------1---1111----------------------------------------------------------------1- -----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 95.8 SQ:SECSTR cTTHHHHEEEGGcccEETTccHHHHHHHHTTccccEEEEcTTccEEEEEcHHHHEHHHHHTccHHHHTccGGGcccccccccTTccHHHHHHHHHHccEHEEEEcTTccEEEEEEHHHHHHHHHHHcTcccccEEEEc###### DISOP:02AL 144-145| PSIPRED cccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHcccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHccccccc //