[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ54992.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->105 PF10944 * DUF2630 8e-10 50.6 %
:HMM:PFM   28->105 PF10944 * DUF2630 1.5e-33 52.6 78/81  
:BLT:SWISS 24->103 Y922_MYCBO 6e-10 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ54992.1 GT:GENE AAZ54992.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1121391..1121708 GB:FROM 1121391 GB:TO 1121708 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ54992.1 GB:DB_XREF GI:71915090 LENGTH 105 SQ:AASEQ MTCKTWRGGLVCRSARAEHGGMNGQHTREEELIRQIGELVTEERALRQQPGHRLSAAEYERIKQVERALDQCWDLLRQRRAKEEFGENPDEARPRSISQVEEYQQ GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 24->103|Y922_MYCBO|6e-10|41.2|80/87| RP:PFM:NREP 1 RP:PFM:REP 29->105|PF10944|8e-10|50.6|77/81|DUF2630| HM:PFM:NREP 1 HM:PFM:REP 28->105|PF10944|1.5e-33|52.6|78/81|DUF2630| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----1----------11----1---1-------1111----1--11------11---1-------1--111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 17-30, 48-59, 82-94, 99-105| PSIPRED cccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHc //