[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55017.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:201 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  30->176 1l0oA_ d.122.1.3 * 9.6e-06 24.8 %
:HMM:PFM   67->113 PF02518 * HATPase_c 4.3e-07 22.2 45/111  
:HMM:PFM   18->53 PF01141 * Gag_p12 0.00052 37.1 35/85  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55017.1 GT:GENE AAZ55017.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1146600..1147205 GB:FROM 1146600 GB:TO 1147205 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55017.1 GB:DB_XREF GI:71915115 LENGTH 201 SQ:AASEQ MMEHLDHSYDEHPDDVLSPATSASQREEDEKPLVSDEWEMPAESALCSELRHRVRDILDVHYSATTVDDIELIASELFANSCRHSLSGDGGKVGIILRGWSEWVYLAVDDQGPKGGARVLWEPEVIDPLAPDGRGLLLVHMLTDGWGQHYHDGTHRVFAWFRIGWEHPERLPNLKELPIRPGMLSDFIPDDPSDPIFNHYY GT:EXON 1|1-201:0| SEG 185->197|sdfipddpsdpif| HM:PFM:NREP 2 HM:PFM:REP 67->113|PF02518|4.3e-07|22.2|45/111|HATPase_c| HM:PFM:REP 18->53|PF01141|0.00052|37.1|35/85|Gag_p12| HM:SCP:REP 30->176|1l0oA_|9.6e-06|24.8|133/141|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------2---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 18-34| PSIPRED cccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHcccEEcccccEEEEEEEccccccccccccccccccccHHHHccccccccccccccc //