[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55025.1
DDBJ      :             small multidrug resistance protein, SMR family
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  306/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->83 1s7bB PDBj 3e-14 43.8 %
:HMM:SCOP  4->109 1s7bA_ f.39.1.1 * 2.6e-13 37.1 %
:RPS:PFM   3->84 PF00893 * Multi_Drug_Res 5e-12 50.6 %
:HMM:PFM   1->94 PF00893 * Multi_Drug_Res 1.1e-25 45.2 93/93  
:BLT:SWISS 1->84 MMR_MYCPA 5e-17 45.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55025.1 GT:GENE AAZ55025.1 GT:PRODUCT small multidrug resistance protein, SMR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1159180..1159503 GB:FROM 1159180 GB:TO 1159503 GB:DIRECTION + GB:PRODUCT small multidrug resistance protein, SMR family GB:PROTEIN_ID AAZ55025.1 GB:DB_XREF GI:71915123 LENGTH 107 SQ:AASEQ MQWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAYGIWSALGVTLVAVIGAVFLGDTLTWVQIVGIVLVIAGVAALELGAAR GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 1->84|MMR_MYCPA|5e-17|45.2|84/107| TM:NTM 4 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 57->79| TM:REGION 84->106| SEG 86->106|vqivgivlviagvaalelgaa| BL:PDB:NREP 1 BL:PDB:REP 3->83|1s7bB|3e-14|43.8|80/107| RP:PFM:NREP 1 RP:PFM:REP 3->84|PF00893|5e-12|50.6|81/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 1->94|PF00893|1.1e-25|45.2|93/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| HM:SCP:REP 4->109|1s7bA_|2.6e-13|37.1|105/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 383 OP:NHOMOORG 312 OP:PATTERN ------------------------1--1---------------------11-1--------------- -1-------------1111-1211121111112---11----1--11--11----2------1-112-111-----------1-----------------1------------------------111-1-1121-11111----------------1111-1----111----------------------11222221211122112-2--21211-111--1------1---------------------1------------------1------------------------------------------------------------------------------1------11-------------1-------------1--1122211-11111111111-----1-1-----1---1111111122-1-1--1111111------------1-21---------------1----------------1--211121222212111122121111112111121-----1-1112-------1-2-11---11---1----111--------111-------1------11-1--------------------------11-1-11---311------21-----111-21---1----------1111-11111111211-2-12--1--221111111-1--1-222-----1--1------21---11111-22222221222211---1-------11--1111---1------1---1-4--11111----1--1-11122--------1----112-111112----1112121111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 74.8 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTcc#ccccccccHHHHHHHHHHHHHTTTTTcccc######################## DISOP:02AL 105-107| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccc //