[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55030.1
DDBJ      :             Lipoate-protein ligase B
Swiss-Prot:LIPB_THEFY   RecName: Full=Octanoyltransferase;         EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B;

Homologs  Archaea  4/68 : Bacteria  608/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->203 1w66A PDBj 5e-58 62.0 %
:RPS:PDB   14->217 2c8mA PDBj 7e-31 15.6 %
:RPS:SCOP  1->216 1w66A1  d.104.1.3 * 5e-50 55.3 %
:HMM:SCOP  9->228 1w66A1 d.104.1.3 * 6e-65 47.3 %
:RPS:PFM   64->166 PF03099 * BPL_LplA_LipB 7e-07 35.4 %
:HMM:PFM   64->170 PF03099 * BPL_LplA_LipB 1.1e-18 32.7 101/125  
:BLT:SWISS 1->236 LIPB_THEFY e-140 100.0 %
:PROS 76->91|PS01313|LIPB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55030.1 GT:GENE AAZ55030.1 GT:PRODUCT Lipoate-protein ligase B GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1163709..1164419) GB:FROM 1163709 GB:TO 1164419 GB:DIRECTION - GB:PRODUCT Lipoate-protein ligase B GB:PROTEIN_ID AAZ55030.1 GB:DB_XREF GI:71915128 InterPro:IPR000544 LENGTH 236 SQ:AASEQ MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAPVIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPDRGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEHHLAAVLGASSYRRIAGWPVLPEFVDA GT:EXON 1|1-236:0| SW:ID LIPB_THEFY SW:DE RecName: Full=Octanoyltransferase; EC=2.3.1.181;AltName: Full=Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase;AltName: Full=Lipoyl/octanoyl transferase;AltName: Full=Lipoate-protein ligase B; SW:GN Name=lipB; OrderedLocusNames=Tfu_0992; SW:KW Acyltransferase; Complete proteome; Cytoplasm; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->236|LIPB_THEFY|e-140|100.0|236/236| GO:SWS:NREP 3 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 76->91|PS01313|LIPB|PDOC01017| BL:PDB:NREP 1 BL:PDB:REP 17->203|1w66A|5e-58|62.0|179/218| RP:PDB:NREP 1 RP:PDB:REP 14->217|2c8mA|7e-31|15.6|186/241| RP:PFM:NREP 1 RP:PFM:REP 64->166|PF03099|7e-07|35.4|96/118|BPL_LplA_LipB| HM:PFM:NREP 1 HM:PFM:REP 64->170|PF03099|1.1e-18|32.7|101/125|BPL_LplA_LipB| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF03099|IPR004143| GO:PFM GO:0006464|"GO:protein modification process"|PF03099|IPR004143| RP:SCP:NREP 1 RP:SCP:REP 1->216|1w66A1|5e-50|55.3|206/216|d.104.1.3| HM:SCP:REP 9->228|1w66A1|6e-65|47.3|205/0|d.104.1.3|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 840 OP:NHOMOORG 776 OP:PATTERN ------------------111----------------------------------------2------ 1111111111111111111-111111111111111111121111111111111111111111111111111-----------1--1111111-111-1111111111111------------------------1-111-1---1111111111111111111111111111111111111111111111-1----------------------------------------1------------------------------------------------------------------------------------------11---------------11-----------------1------1111---1--111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1--11-1111-111-11111111111-1-------------------------111111111111111111111111111111111-1111111-11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111-----------------------------------------------11 --------211-111111-1111111111111111111111111-11111111-11-----111111111111111111111111111-1211111111112111--13-2-1121-111-1111111111--111--1111121-1---11111-1-11121111111171-212222M2221222531332221111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 228 STR:RPRED 96.6 SQ:SECSTR #####EEEEEcccccTTcHHHHHHHHHHHHHHccTTcTccEEEEEccccEEEEcTTccHHHHccHHHTcEEEEcccccccEEEcTTEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHTTcccEEEcccccTTcccccTTccccccTTcEEETTETTEEEEEEEEEccccHHHHHHHTccccccTTcTcccGGGTccccHHHHHHHHHHHHHHHHTEccccEEEHHHHHHHH### DISOP:02AL 1-4, 235-236| PSIPRED ccccHHHHHEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccEEccccccccccccccccccEEEEccccEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccEEEcccccEEEEcccccccccccEEEEEcEEEcccEEEEEEEEEcccccHHHHcccccccccccEEEEHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHccccccHHccc //