[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55039.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55039.1 GT:GENE AAZ55039.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1176990..1177349 GB:FROM 1176990 GB:TO 1177349 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55039.1 GB:DB_XREF GI:71915137 LENGTH 119 SQ:AASEQ MAQELPRSVKAIRILLFVVAALTFVVAAALFIAGGASAYAFGYALALSLPGVVQLGLGLLVPKGGGGVFYAILVTEILLVLVTLAAIVGGDGRVTELVFPVVILVLLSRPSARNFFFDR GT:EXON 1|1-119:0| TM:NTM 3 TM:REGION 10->32| TM:REGION 39->61| TM:REGION 77->99| SEG 15->68|llfvvaaltfvvaaalfiaggasayafgyalalslpgvvqlglgllvpkggggv| SEG 71->88|ailvteillvlvtlaaiv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccc //