[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55052.1
DDBJ      :             putative aminotransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.3
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->58 1dcjA PDBj 4e-10 39.2 %
:RPS:PDB   1->61 1dcjA PDBj 2e-12 34.4 %
:RPS:SCOP  1->61 1pavA  d.68.3.3 * 1e-12 31.1 %
:HMM:SCOP  1->76 1je3A_ d.68.3.3 * 1e-18 28.9 %
:RPS:PFM   7->61 PF01206 * SirA 8e-08 41.8 %
:HMM:PFM   8->63 PF01206 * SirA 1.3e-20 41.1 56/70  
:BLT:SWISS 8->63 TUSA_KLEP7 6e-12 39.3 %
:PROS 9->33|PS01148|UPF0033

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55052.1 GT:GENE AAZ55052.1 GT:PRODUCT putative aminotransferase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1188660..1188896) GB:FROM 1188660 GB:TO 1188896 GB:DIRECTION - GB:PRODUCT putative aminotransferase GB:PROTEIN_ID AAZ55052.1 GB:DB_XREF GI:71915150 InterPro:IPR001455 LENGTH 78 SQ:AASEQ MSEQPLLTIDAIGRKCPVPIIMLANRLREVPIGSVIAVTADDPAARTDIPAWCRMKRHTFLREVPLSRGSAFHVQRMY GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 8->63|TUSA_KLEP7|6e-12|39.3|56/81| PROS 9->33|PS01148|UPF0033|PDOC00884| BL:PDB:NREP 1 BL:PDB:REP 8->58|1dcjA|4e-10|39.2|51/81| RP:PDB:NREP 1 RP:PDB:REP 1->61|1dcjA|2e-12|34.4|61/81| RP:PFM:NREP 1 RP:PFM:REP 7->61|PF01206|8e-08|41.8|55/70|SirA| HM:PFM:NREP 1 HM:PFM:REP 8->63|PF01206|1.3e-20|41.1|56/70|SirA| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF01206|IPR001455| GO:PFM GO:0005737|"GO:cytoplasm"|PF01206|IPR001455| GO:PFM GO:0008033|"GO:tRNA processing"|PF01206|IPR001455| GO:PFM GO:0016783|"GO:sulfurtransferase activity"|PF01206|IPR001455| RP:SCP:NREP 1 RP:SCP:REP 1->61|1pavA|1e-12|31.1|61/78|d.68.3.3| HM:SCP:REP 1->76|1je3A_|1e-18|28.9|76/97|d.68.3.3|1/1|SirA-like| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------1-------------1----1111-----------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1------------------------------------1--------------------------------111---------------------1------------------------------------------111--------1------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 78.2 SQ:SECSTR ccccccEEEccTTccTTHHHHHHHHHHHHccTTccEEEEEccTTHHHHHHHHHHHTTcEEE################# DISOP:02AL 1-2| PSIPRED ccccccEEEEcccccccHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHccEEEEEEEccccEEEEEEEEc //