[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55078.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  202/915 : Eukaryota  27/199 : Viruses  0/175   --->[See Alignment]
d.176.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->184 1xdyG PDBj 6e-11 30.5 %
:RPS:PDB   3->198 2biiA PDBj 1e-32 20.1 %
:RPS:SCOP  7->190 1xdqA  d.176.1.1 * 7e-38 26.0 %
:HMM:SCOP  5->196 1ogpA2 d.176.1.1 * 8.8e-53 36.8 %
:RPS:PFM   52->172 PF00174 * Oxidored_molyb 9e-21 43.0 %
:HMM:PFM   20->172 PF00174 * Oxidored_molyb 3.1e-43 35.8 151/169  
:BLT:SWISS 27->181 Y379_CAMJE 1e-12 29.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55078.1 GT:GENE AAZ55078.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1218724..1219326 GB:FROM 1218724 GB:TO 1219326 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55078.1 GB:DB_XREF GI:71915176 InterPro:IPR008335 LENGTH 200 SQ:AASEQ MSERRLPPGQYVPNEWPAVHYGPVPKFRPHRWDLQVYGATADGTQYRWDWTEFQTLPRVDVVTDFHCVTRFTKLDVRWRGVAASTVLKLAPPAEDATHVMVWAEYGYSANLPLDDFRRPDVILATHRDGKPLEPQHGYPVRLVVPHRYGWKSVKWVRAIEYLTADRRGFWEERGYHNLANPWLEQRYSYQEDPGDGPPLD GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 27->181|Y379_CAMJE|1e-12|29.6|152/297| BL:PDB:NREP 1 BL:PDB:REP 32->184|1xdyG|6e-11|30.5|151/261| RP:PDB:NREP 1 RP:PDB:REP 3->198|2biiA|1e-32|20.1|194/415| RP:PFM:NREP 1 RP:PFM:REP 52->172|PF00174|9e-21|43.0|121/156|Oxidored_molyb| HM:PFM:NREP 1 HM:PFM:REP 20->172|PF00174|3.1e-43|35.8|151/169|Oxidored_molyb| GO:PFM:NREP 1 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00174|IPR000572| RP:SCP:NREP 1 RP:SCP:REP 7->190|1xdqA|7e-38|26.0|181/262|d.176.1.1| HM:SCP:REP 5->196|1ogpA2|8.8e-53|36.8|190/261|d.176.1.1|1/1|Oxidoreductase molybdopterin-binding domain| OP:NHOMO 364 OP:NHOMOORG 265 OP:PATTERN 111-112122222223-21111113112-212-----------11----11----------111---- -1214------------11-11--12-111-111111121-2-213---2--343--1--212-1-43211-----------111122-----------------1-1----------------------------1111111-112113111-------------22231------------41111---1-1-----------------11-1---111----------22--------------------------------------------------------------------------------------------------------------------------------------------1-1-----------2221--22122------------11211311-1--111-1123231112-----------11--------2331121----------------------------------1-----111112-21111--21111111113------221-----1-2-1-11-1-11-1------------2------------------------223221-------11111-----------1-----1--1----1-1----------------------------------1-1-------11-----------------------------------------------2---------------------------------------111---------11-------------1121--1------------------------------------11111111-------------------------------------------------------------1- -------------11-----111--------------------------------11--1-1---------------------------1-1-1-------------111---------------------------------------------------------1-2-----1-11211-1-11-1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 98.0 SQ:SECSTR ##HHHHHTcccccGGccEEEccccccGGGGGcEEEEEEcccTcccEEEEHHHHHHcccEEEEEEEEcTTTTHHHHEEEEEEEHHHHHHHHcccTTccEEEEETTcccEEEEEHHHHTcTccEEEEEETTEEccGGGTTTcEEEcTTccGGGccccEEEEEEEccccccHHHHcccccccTTccHHHHHHcGGGGccGG## DISOP:02AL 1-2, 196-200| PSIPRED ccccccccccEEccccEEEcccccccccccccEEEEEEEEccccEEEEcHHHHHHcccEEEEEEEEEccccEEccEEEEcccHHHHHHHccccccccEEEEEEccccEEEEEHHHHccccEEEEEEEccccccHHcccEEEEEEccccccccEEEEEEEEEEEcccccccEEccccccccccccccccEEEccccccccc //