[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55083.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->123 2kfsA PDBj 2e-17 46.0 %
:RPS:PDB   14->52 1bibA PDBj 5e-05 25.6 %
:HMM:PFM   19->43 PF04545 * Sigma70_r4 2e-06 48.0 25/50  
:HMM:PFM   63->122 PF02909 * TetR_C 0.00029 23.3 60/139  
:PROS 11->24|PS00213|LIPOCALIN

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55083.1 GT:GENE AAZ55083.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1223753..1224130 GB:FROM 1223753 GB:TO 1224130 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55083.1 GB:DB_XREF GI:71915181 InterPro:IPR002345 LENGTH 125 SQ:AASEQ MWKIGTVTQIDRDLDALVGEWLTLQEAAAALGVSQNQVRQMIRNHRLLGVVRGGELAIPAAFITNGTILKGLQGTLTVLADSGFSPEEALRWMFTADDSLPGTPLDAIRGNRGTEVRRRAQAMLL GT:EXON 1|1-125:0| PROS 11->24|PS00213|LIPOCALIN|PDOC00187| BL:PDB:NREP 1 BL:PDB:REP 24->123|2kfsA|2e-17|46.0|100/146| RP:PDB:NREP 1 RP:PDB:REP 14->52|1bibA|5e-05|25.6|39/294| HM:PFM:NREP 2 HM:PFM:REP 19->43|PF04545|2e-06|48.0|25/50|Sigma70_r4| HM:PFM:REP 63->122|PF02909|0.00029|23.3|60/139|TetR_C| OP:NHOMO 59 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----1111111--111111-111111111111-1111111-11111111111111111--111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 96.0 SQ:SECSTR ###cccccHHHHHHHHHTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccTTcccccccccccccccTTcccccccccccccccHHHHHEEEccTTTccEEHHHHEEEEcccccccHHHHH## DISOP:02AL 1-5| PSIPRED ccccccccccccHHHccccccccHHHHHHHHcccHHHHHHHHHcccEEEEEEccEEEccEEEEEcccccccccEEEEEEEcccccHHHHHHHHcccccccccccHHHHHccHHHHHHHHHHHHcc //