[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55087.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:202 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   37->178 1bobA PDBj 3e-04 10.2 %
:RPS:SCOP  88->157 2atrA1  d.108.1.1 * 2e-05 30.8 %
:HMM:SCOP  1->168 1vkcA_ d.108.1.1 * 1.1e-12 26.9 %
:HMM:PFM   102->157 PF00583 * Acetyltransf_1 2.7e-11 39.3 56/83  
:HMM:PFM   47->82 PF07080 * DUF1348 2.5e-05 33.3 36/143  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55087.1 GT:GENE AAZ55087.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1226533..1227141 GB:FROM 1226533 GB:TO 1227141 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55087.1 GB:DB_XREF GI:71915185 LENGTH 202 SQ:AASEQ METEIEFWELAAPAFIRALPALMEIYAAAMAPPPRQLPGRQAIMRQHAHYPRFHSVVAVTGERNAVAFAYGFHGCPGQWWHDVVTAELGRIDPEGVRRWFADSFEVAEVHVLPEWQGNGIGRALLYRLLEPRRERTAVLSTPTGATPAHGLYRSSGFVDLITGFRFPGTVDQEFTIMAAQLPLPAGWRPRAGGRPRGSPSNG GT:EXON 1|1-202:0| SEG 122->135|rallyrlleprrer| SEG 184->200|pagwrpraggrprgsps| RP:PDB:NREP 1 RP:PDB:REP 37->178|1bobA|3e-04|10.2|137/306| HM:PFM:NREP 2 HM:PFM:REP 102->157|PF00583|2.7e-11|39.3|56/83|Acetyltransf_1| HM:PFM:REP 47->82|PF07080|2.5e-05|33.3|36/143|DUF1348| RP:SCP:NREP 1 RP:SCP:REP 88->157|2atrA1|2e-05|30.8|65/132|d.108.1.1| HM:SCP:REP 1->168|1vkcA_|1.1e-12|26.9|145/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- -----1111111111------1---1------11111111-111----------------11--1111111---------------------------------------------------------------------------------------------------------------------------11111111-111-11-------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 82.2 SQ:SECSTR ############EEEEEcHHHHHHHHHHHTHHHHccHHHHHHHHHHTHHHHHHcTTcccccTTcTTEEEEEEEETTTccEEEEEEEEEEcccccccEEEcTcEEEEEEEEEcGGGccccHHHHHHHHHHHHHcTTEEEEEEccccHHHHHHHHHHHHHHHHHTTHHHHTTcTTcccHH######################## DISOP:02AL 1-2, 189-202| PSIPRED cccccHHEEccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccEEEEEEEccccEEEEEEccccccccccHHHHHHHHccccccHHHHHHccEEEEEEEEEcHHHHcccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccHHHHHcccccccccccccEEHHHccccccccccccccccccccccc //