[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55096.1
DDBJ      :             dihydroorotate oxidase B, electron transfer subunit
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  221/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->265 1ep1B PDBj 1e-21 34.9 %
:RPS:PDB   27->229 1bx0A PDBj 2e-13 17.7 %
:RPS:SCOP  13->105 1ep1B1  b.43.4.2 * 1e-06 27.8 %
:RPS:SCOP  100->267 1ep1B2  c.25.1.3 * 9e-19 28.9 %
:HMM:SCOP  5->105 1ep3B1 b.43.4.2 * 1.2e-11 35.7 %
:HMM:SCOP  100->267 1ep3B2 c.25.1.3 * 6.6e-36 34.6 %
:RPS:PFM   224->265 PF10418 * DHODB_Fe-S_bind 5e-05 56.8 %
:HMM:PFM   224->265 PF10418 * DHODB_Fe-S_bind 2.3e-17 53.8 39/40  
:HMM:PFM   116->208 PF00175 * NAD_binding_1 4.2e-13 33.3 93/109  
:HMM:PFM   35->103 PF00970 * FAD_binding_6 0.00013 27.3 66/99  
:BLT:SWISS 29->270 PYRK_THEMA 4e-29 37.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55096.1 GT:GENE AAZ55096.1 GT:PRODUCT dihydroorotate oxidase B, electron transfer subunit GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1238263..1239153 GB:FROM 1238263 GB:TO 1239153 GB:DIRECTION + GB:PRODUCT dihydroorotate oxidase B, electron transfer subunit GB:PROTEIN_ID AAZ55096.1 GB:DB_XREF GI:71915194 LENGTH 296 SQ:AASEQ MSDVRPVQMSSPVLTVRQVDAYHAITVVAPGIAERFRSGQFVAVAVGGEHSAMLTRRMFAIHEVKPDYGGTVEFLFTVRGKGTAWLAERRSRDLLDIIGPLGRPFPLPRDPVNCVLVGGGSGSVPLFPLAHALRRRGCRVDFVLGGATASRVFNAMTARRIAETATFTTDDGSLGTKGRVTDVLAQVIEEAYSDVVYACGPMPMLREVTAIAMHYGIPIQVSVEETMACGTGICMSCVVPVVGEDGITRMARACVDGPVFRGERVRFDDVGTVPFDALGAPGWKARSVEDQAREAG GT:EXON 1|1-296:0| BL:SWS:NREP 1 BL:SWS:REP 29->270|PYRK_THEMA|4e-29|37.0|230/282| SEG 117->124|vgggsgsv| BL:PDB:NREP 1 BL:PDB:REP 7->265|1ep1B|1e-21|34.9|249/261| RP:PDB:NREP 1 RP:PDB:REP 27->229|1bx0A|2e-13|17.7|203/296| RP:PFM:NREP 1 RP:PFM:REP 224->265|PF10418|5e-05|56.8|37/38|DHODB_Fe-S_bind| HM:PFM:NREP 3 HM:PFM:REP 224->265|PF10418|2.3e-17|53.8|39/40|DHODB_Fe-S_bind| HM:PFM:REP 116->208|PF00175|4.2e-13|33.3|93/109|NAD_binding_1| HM:PFM:REP 35->103|PF00970|0.00013|27.3|66/99|FAD_binding_6| RP:SCP:NREP 2 RP:SCP:REP 13->105|1ep1B1|1e-06|27.8|90/101|b.43.4.2| RP:SCP:REP 100->267|1ep1B2|9e-19|28.9|159/160|c.25.1.3| HM:SCP:REP 5->105|1ep3B1|1.2e-11|35.7|98/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 100->267|1ep3B2|6.6e-36|34.6|159/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 392 OP:NHOMOORG 257 OP:PATTERN --11------------1------1--------11111111111122222222213333341--12-1- -1--------------------------------------1----------------------1------111111112121-2111122222222-----------------------------22222122222-----222--------------------------------------------222-111111111111111111111111111111111111111--1--------------1----2----------------1-----111-------11111111111111-------------111111111-2111433333334342222222223221122221122212122333111--11-----------------22112--------------1--------------------------------------------------------------------------------------------1----1-----------------------------------1-------------------------212221322122112121122321111--22---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------11-2--------------11-------------------1------2121111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 88.9 SQ:SECSTR cTTTccHHHHHHHccccccEEEEcccEEEcTTcccccTTcEEEEEcccccTTccccEEEEccTcTTccccEEEEEEEcccHHHHHHHHccTTcEEEEEEEEccTTcccccTTEEEEEEEGGGGHHHHHHHHHHHTcccEEEEEEEEccGGGcccHHHHHHHHHEEETTTcccTTcccccHHHHHGGGHHHHHTEEEEEEEcTHHHHHHHHHHHHHHHTcHHHHHHHHHHccccccTTEEE##cccTTccEEETTTTccEEETTTT############################### DISOP:02AL 1-3, 280-296| PSIPRED ccccccEEEEEEEEEEEEEccEEEEEEEcccHHHHcccccEEEEEEEccccccEEEEEEEEEccccccccEEEEEEEEcccHHHHHHHcccccEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEccccccccEEEEEEEccccEEcHHHEEHHHcccccccccccHHHHHHHHHHHHHccc //