[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55101.1
DDBJ      :             RNA polymerase, omega subunit
Swiss-Prot:RPOZ_THEFY   RecName: Full=DNA-directed RNA polymerase subunit omega;         Short=RNAP omega subunit;         EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit;

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.143.1
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->40 1ynjK PDBj 2e-04 50.0 %
:RPS:PDB   10->83 2e2iF PDBj 4e-12 22.2 %
:RPS:SCOP  14->88 1iw7E  a.143.1.1 * 2e-15 28.0 %
:HMM:SCOP  11->88 1i6vE_ a.143.1.1 * 3.1e-25 57.7 %
:RPS:PFM   17->78 PF01192 * RNA_pol_Rpb6 6e-07 60.8 %
:HMM:PFM   17->43 PF01192 * RNA_pol_Rpb6 2.1e-09 34.6 26/57  
:HMM:PFM   57->81 PF01192 * RNA_pol_Rpb6 1e-06 44.0 25/57  
:BLT:SWISS 1->88 RPOZ_THEFY 8e-46 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55101.1 GT:GENE AAZ55101.1 GT:PRODUCT RNA polymerase, omega subunit GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1242703..1242969 GB:FROM 1242703 GB:TO 1242969 GB:DIRECTION + GB:PRODUCT RNA polymerase, omega subunit GB:PROTEIN_ID AAZ55101.1 GB:DB_XREF GI:71915199 InterPro:IPR003716 LENGTH 88 SQ:AASEQ MAGTPPVAEGITNPPIDELLEVVDSKYSLVTMAAKRARQINAYYAQLGEGLLEYVGPLVETQPQEKPLSIALREIREGLLTAETQEEA GT:EXON 1|1-88:0| SW:ID RPOZ_THEFY SW:DE RecName: Full=DNA-directed RNA polymerase subunit omega; Short=RNAP omega subunit; EC=2.7.7.6;AltName: Full=Transcriptase subunit omega;AltName: Full=RNA polymerase omega subunit; SW:GN Name=rpoZ; OrderedLocusNames=Tfu_1063; SW:KW Complete proteome; DNA-directed RNA polymerase;Nucleotidyltransferase; Transcription; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->88|RPOZ_THEFY|8e-46|100.0|88/88| GO:SWS:NREP 4 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 11->40|1ynjK|2e-04|50.0|30/95| RP:PDB:NREP 1 RP:PDB:REP 10->83|2e2iF|4e-12|22.2|63/86| RP:PFM:NREP 1 RP:PFM:REP 17->78|PF01192|6e-07|60.8|51/57|RNA_pol_Rpb6| HM:PFM:NREP 2 HM:PFM:REP 17->43|PF01192|2.1e-09|34.6|26/57|RNA_pol_Rpb6| HM:PFM:REP 57->81|PF01192|1e-06|44.0|25/57|RNA_pol_Rpb6| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01192|IPR006110| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01192|IPR006110| GO:PFM GO:0006351|"GO:transcription, DNA-dependent"|PF01192|IPR006110| RP:SCP:NREP 1 RP:SCP:REP 14->88|1iw7E|2e-15|28.0|75/95|a.143.1.1| HM:SCP:REP 11->88|1i6vE_|3.1e-25|57.7|78/0|a.143.1.1|1/1|RPB6/omega subunit-like| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-1111111111111111111111111111111111111111111111111111111111----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 71.6 SQ:SECSTR #########ccccccccccccccccHHHHHHHHHHHHHHHTTccc###########ccccccccccTTHHHHHHHHTTccccE##### DISOP:02AL 1-5, 84-88| PSIPRED cccccccccccccccHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccc //