[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55106.1
DDBJ      :             glutaryl-CoA dehydrogenase
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  527/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->395 2ebaA PDBj 1e-91 48.3 %
:RPS:PDB   22->389 2dvlA PDBj 7e-66 33.9 %
:RPS:SCOP  11->235 1siqA2  e.6.1.1 * 4e-69 48.0 %
:RPS:SCOP  249->395 1siqA1  a.29.3.1 * 3e-17 39.5 %
:HMM:SCOP  8->238 1w07A3 e.6.1.2 * 2.8e-71 47.2 %
:HMM:SCOP  241->391 1bucA1 a.29.3.1 * 7.5e-39 35.1 %
:RPS:PFM   25->136 PF02771 * Acyl-CoA_dh_N 2e-13 37.3 %
:RPS:PFM   141->192 PF02770 * Acyl-CoA_dh_M 4e-09 51.9 %
:RPS:PFM   280->387 PF00441 * Acyl-CoA_dh_1 1e-11 31.5 %
:HMM:PFM   242->388 PF00441 * Acyl-CoA_dh_1 1e-33 32.7 147/150  
:HMM:PFM   23->136 PF02771 * Acyl-CoA_dh_N 1.2e-31 42.9 112/113  
:HMM:PFM   140->190 PF02770 * Acyl-CoA_dh_M 1.6e-23 51.0 51/52  
:BLT:SWISS 2->395 GCDH_BOVIN 5e-82 43.4 %
:PROS 142->154|PS00072|ACYL_COA_DH_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55106.1 GT:GENE AAZ55106.1 GT:PRODUCT glutaryl-CoA dehydrogenase GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1247799..1248989) GB:FROM 1247799 GB:TO 1248989 GB:DIRECTION - GB:PRODUCT glutaryl-CoA dehydrogenase GB:PROTEIN_ID AAZ55106.1 GB:DB_XREF GI:71915204 InterPro:IPR006089 LENGTH 396 SQ:AASEQ MSTSHGPAAPDPLDFLAVDSSLSAEERAVRDTVREFGRRELLPHVAEWFAAGTIPDPHGLARKFGQLGLLGMHLDGYGCPGAGAVAYGLACRELEAVDSGLRSFVSVQGSLAMTAIHRYGSEEQKQQWLPRMAAGEAIGCFGLTEPDSGSDPGAMRTRARRVGADWVLTGTKMWITNGSVADVAVVWAGTEEGIRGFLVPAGTPGFTATVIERKLSLRASITAALSLDEVRLPDSARLPLAAGLRAPLSCLTEARYGIVWGAAGAARACYEAALEYATSREQFGQPIAAFQLTQRKLAEMVVDVNQASLTALHLGRLKEAGACHHYQVSFGKLANVAAAQRVAAKARSVHGANGITLDYPVLRHLLNLETVATYEGTEEIHTLSLGQAVTGISAFR GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 2->395|GCDH_BOVIN|5e-82|43.4|392/438| PROS 142->154|PS00072|ACYL_COA_DH_1|PDOC00070| SEG 236->248|arlplaaglrapl| SEG 261->277|gaagaaracyeaaleya| SEG 334->347|anvaaaqrvaakar| BL:PDB:NREP 1 BL:PDB:REP 13->395|2ebaA|1e-91|48.3|377/380| RP:PDB:NREP 1 RP:PDB:REP 22->389|2dvlA|7e-66|33.9|366/370| RP:PFM:NREP 3 RP:PFM:REP 25->136|PF02771|2e-13|37.3|110/113|Acyl-CoA_dh_N| RP:PFM:REP 141->192|PF02770|4e-09|51.9|52/53|Acyl-CoA_dh_M| RP:PFM:REP 280->387|PF00441|1e-11|31.5|108/150|Acyl-CoA_dh_1| HM:PFM:NREP 3 HM:PFM:REP 242->388|PF00441|1e-33|32.7|147/150|Acyl-CoA_dh_1| HM:PFM:REP 23->136|PF02771|1.2e-31|42.9|112/113|Acyl-CoA_dh_N| HM:PFM:REP 140->190|PF02770|1.6e-23|51.0|51/52|Acyl-CoA_dh_M| GO:PFM:NREP 6 GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02771|IPR006092| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02771|IPR006092| GO:PFM GO:0003995|"GO:acyl-CoA dehydrogenase activity"|PF02770|IPR006091| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02770|IPR006091| GO:PFM GO:0016627|"GO:oxidoreductase activity, acting on the CH-CH group of donors"|PF00441|IPR006090| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00441|IPR006090| RP:SCP:NREP 2 RP:SCP:REP 11->235|1siqA2|4e-69|48.0|223/236|e.6.1.1| RP:SCP:REP 249->395|1siqA1|3e-17|39.5|147/154|a.29.3.1| HM:SCP:REP 8->238|1w07A3|2.8e-71|47.2|229/0|e.6.1.2|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 241->391|1bucA1|7.5e-39|35.1|151/151|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 5365 OP:NHOMOORG 721 OP:PATTERN 22----4555755645-233332C96661-7B-----------------------------3451--- 4556O3-5111634PsbHH-Hd22bbHHHHHTedmdTd**4S7c1133-11-667668--GCR1DCNIGLD--------123B-----11111122---41445464535--------------------------66588---B3-1-1------------------12-------------67767--19635555545555555553455545557A97A11------42-111111-11111111---1--1------------------------------------------------------------------111315444444444423222221-6-3-4-13-551487-17---11-3-61-JEEO-----1-PHI332NEOKH88787885757-44944C29A8O-4553535556568A6I99BB7777C8D111111117----886------------------------------GJSH17MDBJA9BCH98488899GCCCCD8CL9SPifZ13DD9B5CCCHACDFU115----35-------1-2D663UCC-----------765-9-5--77879965---------------------------32-3B2668414333344533334363344---11--------2142-111112122111-1111111111111111111111--11-1111111---1111111-1-1111--1111111-1111---5111115555-GB-1---------------EEECEAC46561JJJL7FCCGB7A9A535-------------2-----24-224444444444-------2997799----------1-------------------------1--11-1------ ----558-731-7878876A677866A88275664668778887768655678A455434444--------------------------69687764555587999-954FCSBBDC68768B8D95F7M*B-B9L5854C68D929755B73C9CB9J7AC6HAC677BADFAF2221G2-143454962344C9989 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 394 STR:RPRED 99.5 SQ:SECSTR ##HHTTcccccTTcTTcHTTcccHHHHHHHHHHHHHHHHTHHHHHHHHHHTTcccHHHHHHHHHHHTTGGGTTcGGGTcccccHHHHHHHHHHHHHHcHHHHHHHHHHTcHHHHHHHHHccHHHHHHTHHHHHTTcccEEEEcccccccccGGGcccEEEEETTEEEEEEEEEEEETTTTccEEEEEEEETTEEEEEEEETTcTTEEEcccccccccTTccEEEEEEEEEEEEGGEEccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEETTEEGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGGGcGGGcHHHHHHHHHGGGTTTccHHHHHHHHHHHHHcccccH DISOP:02AL 1-9| PSIPRED ccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHccHHHHHHHcHHHHcccEEEEEEEccccccccHHHcEEEEEEEccEEEEEEEEEEEcccccccEEEEEEEEccccEEEEEEcccccEEEcccccccccccccccEEEEccEEEcHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccc //