[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55110.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:264 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   23->238 PF10127 * Nuc-transf 8e-12 28.0 %
:HMM:PFM   11->247 PF10127 * Nuc-transf 1.2e-36 29.2 212/247  
:BLT:SWISS 163->257 Y05G_BPT4 4e-06 29.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55110.1 GT:GENE AAZ55110.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1251780..1252574) GB:FROM 1251780 GB:TO 1252574 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55110.1 GB:DB_XREF GI:71915208 LENGTH 264 SQ:AASEQ MKHSTPEFAAIAERGTVLRCQVGSEVHGIAVPGHGDRDEIGMCIEPPEYVIGLRSFEQYLYRTQPEGSRSGPGDLDVTVYSLRKWTRLALAGNPTVLIPLFVPDTAIVRITDVGRELRAHADRFVSRTAGRRFLGYLRDQRDRLLGRRGGRHTNRPELVDRYGFDVKFAAHLVRLGIQGVELLETGRLTLPMREPWRTWLRDLRQGRHSRDEVLDVAADYEQRLVDLIARSDLPDQADHAWADAWLVRVYRETWRSWEQQGASR GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 163->257|Y05G_BPT4|4e-06|29.0|93/100| SEG 134->151|lgylrdqrdrllgrrggr| RP:PFM:NREP 1 RP:PFM:REP 23->238|PF10127|8e-12|28.0|193/214|Nuc-transf| HM:PFM:NREP 1 HM:PFM:REP 11->247|PF10127|1.2e-36|29.2|212/247|Nuc-transf| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------1-------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-9, 261-264| PSIPRED cccccHHHHHHHHcccEEEEEcccEEEccccccccccccccEEEccHHHEEEccccccccccccccEEEcccccEEEEHHHHHHHHHHHHcccccEEEHHHccccccEEccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccc //