[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55123.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->90 2arzB PDBj 8e-11 24.1 %
:RPS:SCOP  4->90 2arzA1  b.45.1.1 * 1e-12 23.2 %
:RPS:PFM   12->86 PF10615 * DUF2470 5e-10 36.0 %
:HMM:PFM   3->86 PF10615 * DUF2470 5.4e-22 32.1 81/83  
:BLT:SWISS 30->95 KDSB_GEOMG 8e-05 40.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55123.1 GT:GENE AAZ55123.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1267924..1268250) GB:FROM 1267924 GB:TO 1268250 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55123.1 GB:DB_XREF GI:71915221 LENGTH 108 SQ:AASEQ MSATPFSPDVVAAVTQHMNDDHPDDTLLIVRAFGGYPEATAARMTGLDGTAGEYSATVDGREVAVRIPWSQPLTERAQIRTEVVRLYREACARLGVAPRGEAQEGTEH GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 30->95|KDSB_GEOMG|8e-05|40.6|64/254| RP:PDB:NREP 1 RP:PDB:REP 3->90|2arzB|8e-11|24.1|83/235| RP:PFM:NREP 1 RP:PFM:REP 12->86|PF10615|5e-10|36.0|75/83|DUF2470| HM:PFM:NREP 1 HM:PFM:REP 3->86|PF10615|5.4e-22|32.1|81/83|DUF2470| RP:SCP:NREP 1 RP:SCP:REP 4->90|2arzA1|1e-12|23.2|82/238|b.45.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 77.8 SQ:SECSTR ##ccTTTTHHHHHHHHHHHHHcHHHHHHHHHTHHTcccccccEEEEEc####ccEEEEEETTEEEEEEcccccccHHHHHHHHHHHHHcc################## DISOP:02AL 1-4, 92-108| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccccc //