[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55132.1
DDBJ      :             NusB antitermination factor
Swiss-Prot:NUSB_THEFY   RecName: Full=N utilization substance protein B homolog;         Short=Protein nusB;

Homologs  Archaea  0/68 : Bacteria  479/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.79.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->134 1eyvB PDBj 5e-28 48.0 %
:RPS:PDB   9->133 3d3cA PDBj 2e-26 30.6 %
:RPS:SCOP  10->134 1eyvA  a.79.1.1 * 3e-26 51.2 %
:HMM:SCOP  9->134 1eyvA_ a.79.1.1 * 2e-36 39.7 %
:RPS:PFM   13->133 PF01029 * NusB 3e-13 37.8 %
:HMM:PFM   11->133 PF01029 * NusB 1.1e-34 38.2 123/134  
:BLT:SWISS 1->142 NUSB_THEFY 2e-77 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55132.1 GT:GENE AAZ55132.1 GT:PRODUCT NusB antitermination factor GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1275011..1275439 GB:FROM 1275011 GB:TO 1275439 GB:DIRECTION + GB:PRODUCT NusB antitermination factor GB:PROTEIN_ID AAZ55132.1 GB:DB_XREF GI:71915230 InterPro:IPR011605 LENGTH 142 SQ:AASEQ MGGSRRRGSRHKARVRAVEILYEAEVRGVPVSEVIERRRAQTEPPINEFTEQLATRVDEHRARIDELLETYAIGWTLDRMPVVDRNILRIGVYELLWADDIPDGVAIAEAVAMAKELSTDESPVFVNGLLSRLMEKKPSLSL GT:EXON 1|1-142:0| SW:ID NUSB_THEFY SW:DE RecName: Full=N utilization substance protein B homolog; Short=Protein nusB; SW:GN Name=nusB; OrderedLocusNames=Tfu_1094; SW:KW Complete proteome; Transcription; Transcription regulation;Transcription termination. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|NUSB_THEFY|2e-77|100.0|142/142| GO:SWS:NREP 3 GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0006353|"GO:transcription termination"|Transcription termination| BL:PDB:NREP 1 BL:PDB:REP 10->134|1eyvB|5e-28|48.0|125/133| RP:PDB:NREP 1 RP:PDB:REP 9->133|3d3cA|2e-26|30.6|124/138| RP:PFM:NREP 1 RP:PFM:REP 13->133|PF01029|3e-13|37.8|119/124|NusB| HM:PFM:NREP 1 HM:PFM:REP 11->133|PF01029|1.1e-34|38.2|123/134|NusB| GO:PFM:NREP 2 GO:PFM GO:0003723|"GO:RNA binding"|PF01029|IPR006027| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01029|IPR006027| RP:SCP:NREP 1 RP:SCP:REP 10->134|1eyvA|3e-26|51.2|125/131|a.79.1.1| HM:SCP:REP 9->134|1eyvA_|2e-36|39.7|126/131|a.79.1.1|1/1|NusB-like| OP:NHOMO 481 OP:NHOMOORG 479 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111--11111111111-111111111111-1----------1-------1---1---------------1111111111111111-1111111111111111-------1--1111------------111--111111111111111111111111111111111111111111111111111111111111111111-1----1---1111--1-1------111111111111111111111-------1-----111111111-111-1111111111111111111111-12111111111111111111----11111---------11---11--111111111111-11111111-1--111-111---11--1----------------------------------------------------------1-1-------------------------------------------------------------------------111111111111111111111111111111111-1-1111111---------11111--111-1-1--111111111111111111111---------------1--1-1111111-11-111111111111111111-111--111-----------1-1---1111111---11111111111--------------------------------------------1-----------------------------------------11--------1111--11111111-111111111--------------------------1111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 93.0 SQ:SECSTR #####cccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccTTccHHHHHHHHHHTcHHHHHHHHGGGcTTTccccccHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHccTTHHHHHHHHHHHHTTcc##### DISOP:02AL 1-13, 141-142| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccc //