[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55141.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   74->115 PF04977 * DivIC 5.3e-08 31.0 42/80  
:HMM:PFM   45->93 PF06305 * DUF1049 0.00011 30.6 49/80  
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55141.1 GT:GENE AAZ55141.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1284918..1285337 GB:FROM 1284918 GB:TO 1285337 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ55141.1 GB:DB_XREF GI:71915239 LENGTH 139 SQ:AASEQ METKTVERTKTAQSTSRTARPRPRAGHPAAARSGPRTRPSAPRLPFVLLVLGLLGGAMITLLMLHAVLAEDTFEIATLQRENRELSQQEQTLREQVMRAESPEAIAKAAEEMGMYPGEEPQFLDLDSGQITENPRSTGE GT:EXON 1|1-139:0| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 73->101| TM:NTM 1 TM:REGION 44->66| SEG 19->36|arprpraghpaaarsgpr| SEG 47->56|vllvlgllgg| HM:PFM:NREP 2 HM:PFM:REP 74->115|PF04977|5.3e-08|31.0|42/80|DivIC| HM:PFM:REP 45->93|PF06305|0.00011|30.6|49/80|DUF1049| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-39, 81-101, 130-139| PSIPRED ccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccEEEccccccccccccccc //