[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55172.1
DDBJ      :             transposase-related protein
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  183/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.57
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->130 2vjuB PDBj 5e-46 57.4 %
:RPS:PDB   5->129 2ec2A PDBj 1e-33 41.6 %
:RPS:SCOP  6->130 2a6mA1  d.58.57.1 * 2e-33 57.6 %
:HMM:SCOP  2->130 2a6oA1 d.58.57.1 * 3.9e-45 51.9 %
:RPS:PFM   17->126 PF01797 * Transposase_17 6e-21 39.1 %
:HMM:PFM   12->129 PF01797 * Transposase_17 1.4e-46 54.2 118/121  
:BLT:SWISS 6->129 T200_SALTY 2e-17 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55172.1 GT:GENE AAZ55172.1 GT:PRODUCT transposase-related protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1325757..1326155) GB:FROM 1325757 GB:TO 1326155 GB:DIRECTION - GB:PRODUCT transposase-related protein GB:PROTEIN_ID AAZ55172.1 GB:DB_XREF GI:71915270 InterPro:IPR002686 LENGTH 132 SQ:AASEQ MAVTLRSNSNVVFQCAYHVVWCPKYRRRVLGGRIEERLKDLIREVVDEKGAWLVEMEVMPDHVHLLVEVDPQYGIHRLVKAIKGRSSRVLREEFPHLKSRLPTLWTNSYFVATVGGAPLAVVKRYVEQQKGR GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 6->129|T200_SALTY|2e-17|32.5|123/152| BL:PDB:NREP 1 BL:PDB:REP 2->130|2vjuB|5e-46|57.4|129/135| RP:PDB:NREP 1 RP:PDB:REP 5->129|2ec2A|1e-33|41.6|125/130| RP:PFM:NREP 1 RP:PFM:REP 17->126|PF01797|6e-21|39.1|110/119|Transposase_17| HM:PFM:NREP 1 HM:PFM:REP 12->129|PF01797|1.4e-46|54.2|118/121|Transposase_17| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01797|IPR002686| GO:PFM GO:0004803|"GO:transposase activity"|PF01797|IPR002686| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01797|IPR002686| RP:SCP:NREP 1 RP:SCP:REP 6->130|2a6mA1|2e-33|57.6|125/130|d.58.57.1| HM:SCP:REP 2->130|2a6oA1|3.9e-45|51.9|129/0|d.58.57.1|1/1|Transposase IS200-like| OP:NHOMO 1209 OP:NHOMOORG 207 OP:PATTERN --1---1-7224--17--------24431193------------------1CB-----1-1-12---- ---------------------2-----1----1-----11--37----------------------12--2----1-----1-----1--------4------1----2------------------------3--B---1-----43A-747G1----------C-27---------------19-------------5------11238-------51--13-------3-------1-12---12-322-1------9--1--JJ---3-----------12----2-----1--1---------------4411-222-43-1------1--3-A111-2-A-32-3----332B12--21----2--3----------------11---1---------------------------------3------------1---------------1--------------------------B-----------------------------------------------------------1--------------------1--4---41----1-1-----------3-1-------------------3-7----------1------1-1--228-2-----24--------9--34-------------4---21H-1-111-1---183212216-----1---1--8E7--71---4-1R7R71---1------3*rl5***uF2E------------------------------24-------------------------------------------E47447--------------------------------1--1--------------------------------3-313-2--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 99.2 SQ:SECSTR #ccccEEccccEEccEEEEEEcccccTTcccTHHHHHHHHHHHHHHHHHTcEEEEEEEETTEEEEEEEccTTccHHHHHHHHHHHHHHHHHHTTHHHHTTTccccccccEEEEEccccHHHHHHHHHHcccc DISOP:02AL 1-5, 129-132| PSIPRED ccccccccccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHccc //