[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55198.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:203 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   155->194 PF09534 * Trp_oprn_chp 2e-04 60.0 %
:HMM:PFM   16->194 PF09534 * Trp_oprn_chp 1.4e-25 33.1 178/189  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55198.1 GT:GENE AAZ55198.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1352755..1353366 GB:FROM 1352755 GB:TO 1353366 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID AAZ55198.1 GB:DB_XREF GI:71915296 LENGTH 203 SQ:AASEQ MSNSTPRPVRREYLAALALLALGAVALLAAAPQVWAAVRIDLAEDLAPVTVELSAAELAPVSSALGWTALAALAAVVATRGAARRAVGALVVLLGVGAGTAVVLGIRPAALAAAAEQATTVEGTLGDPAVAWQWPVLAGAGAVLLCVAGVLTLVRGTAWPVMSSRYDRHSAPRATRTGAPADLWRSLDSGADPTDENAEPKER GT:EXON 1|1-203:0| TM:NTM 4 TM:REGION 15->37| TM:REGION 53->75| TM:REGION 88->110| TM:REGION 133->155| SEG 14->38|laalallalgavallaaapqvwaav| SEG 64->105|algwtalaalaavvatrgaarravgalvvllgvgagtavvlg| SEG 109->118|aalaaaaeqa| SEG 136->154|vlagagavllcvagvltlv| RP:PFM:NREP 1 RP:PFM:REP 155->194|PF09534|2e-04|60.0|40/187|Trp_oprn_chp| HM:PFM:NREP 1 HM:PFM:REP 16->194|PF09534|1.4e-25|33.1|178/189|Trp_oprn_chp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 190-203| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHcccccccccccEEEcHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccc //