[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55200.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->121 PF04505 * CD225 7e-10 38.9 %
:HMM:PFM   33->111 PF04505 * CD225 1.3e-24 35.4 79/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55200.1 GT:GENE AAZ55200.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1353829..1354239 GB:FROM 1353829 GB:TO 1354239 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55200.1 GB:DB_XREF GI:71915298 LENGTH 136 SQ:AASEQ MRRVLKKRNYGKTRTMSYGPPPGPPPGGFTPPPGYPSGGQPAAQPPKNYLWMNILGILGCTVIGIIGLVFSLQVNKKWEMGDYAGAESASSTAKILGIIGVIGFAIGIVMLLLSIIFTVMLGAAVTSDPSYPYTTP GT:EXON 1|1-136:0| TM:NTM 2 TM:REGION 51->73| TM:REGION 98->120| SEG 19->39|gpppgpppggftpppgypsgg| SEG 95->108|ilgiigvigfaigi| RP:PFM:NREP 1 RP:PFM:REP 40->121|PF04505|7e-10|38.9|72/80|CD225| HM:PFM:NREP 1 HM:PFM:REP 33->111|PF04505|1.3e-24|35.4|79/82|CD225| GO:PFM:NREP 2 GO:PFM GO:0009607|"GO:response to biotic stimulus"|PF04505|IPR007593| GO:PFM GO:0016021|"GO:integral to membrane"|PF04505|IPR007593| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-45, 134-136| PSIPRED ccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //