[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55204.1
DDBJ      :             tryptophan synthase, alpha chain
Swiss-Prot:TRPA_THEFY   RecName: Full=Tryptophan synthase alpha chain;         EC=4.2.1.20;

Homologs  Archaea  36/68 : Bacteria  709/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->257 1rd5A PDBj 7e-28 30.5 %
:RPS:PDB   1->257 2clfA PDBj 2e-15 25.1 %
:RPS:SCOP  16->246 1geqA  c.1.2.4 * 1e-22 26.8 %
:HMM:SCOP  1->243 1xcfA_ c.1.2.4 * 1.6e-75 45.0 %
:RPS:PFM   9->246 PF00290 * Trp_syntA 3e-40 43.8 %
:HMM:PFM   9->257 PF00290 * Trp_syntA 1.9e-71 41.4 244/259  
:BLT:SWISS 1->257 TRPA_THEFY e-122 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55204.1 GT:GENE AAZ55204.1 GT:PRODUCT tryptophan synthase, alpha chain GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1357309..1358121 GB:FROM 1357309 GB:TO 1358121 GB:DIRECTION + GB:PRODUCT tryptophan synthase, alpha chain GB:PROTEIN_ID AAZ55204.1 GB:DB_XREF GI:71915302 InterPro:IPR002028 InterPro:IPR003009 LENGTH 270 SQ:AASEQ MTVLRRKLAEAKAEGRAALVGYYPAGFPDVASSIRVVQAMVAGGCDVIEVGFPYSDPTMDGPVIQQAADRALAAGTTPKDVLAVVRAVADAGAAALVMSYWNPIEKYGVDAFAADLAAAGGSGLITPDLIPEEAEPWIKASDAAGIDRIFLVAPSSTDERLAKTCAASRGFVYAASLMGVTGTRDKVAATARRLVERTRAVTRDSGLPICVGLGISNGAQAAEVASYADGVIVGTGFCQRVLDAPDVDTACQQVRDFAAELAAGVRAAAR GT:EXON 1|1-270:0| SW:ID TRPA_THEFY SW:DE RecName: Full=Tryptophan synthase alpha chain; EC=4.2.1.20; SW:GN Name=trpA; OrderedLocusNames=Tfu_1166; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Lyase; Tryptophan biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->257|TRPA_THEFY|e-122|100.0|257/270| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0000162|"GO:tryptophan biosynthetic process"|Tryptophan biosynthesis| SEG 80->97|dvlavvravadagaaalv| SEG 108->124|gvdafaadlaaaggsgl| SEG 258->269|aaelaagvraaa| BL:PDB:NREP 1 BL:PDB:REP 8->257|1rd5A|7e-28|30.5|243/261| RP:PDB:NREP 1 RP:PDB:REP 1->257|2clfA|2e-15|25.1|239/253| RP:PFM:NREP 1 RP:PFM:REP 9->246|PF00290|3e-40|43.8|235/255|Trp_syntA| HM:PFM:NREP 1 HM:PFM:REP 9->257|PF00290|1.9e-71|41.4|244/259|Trp_syntA| GO:PFM:NREP 2 GO:PFM GO:0004834|"GO:tryptophan synthase activity"|PF00290|IPR002028| GO:PFM GO:0006568|"GO:tryptophan metabolic process"|PF00290|IPR002028| RP:SCP:NREP 1 RP:SCP:REP 16->246|1geqA|1e-22|26.8|220/241|c.1.2.4| HM:SCP:REP 1->243|1xcfA_|1.6e-75|45.0|240/0|c.1.2.4|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 900 OP:NHOMOORG 862 OP:PATTERN -----------------------111111111111111111111111111111111--1-------11 11111111---11111111-11111111111111111111121111111111111111--111111111111111111----111111111111---111-111111111-1111-1-11-----111111111111111111111112111121111111111111122111111111111111-1111-11111111111-111111111111111111111111111111-1111111111111111111----11-----11--11----1-111-------11111111111111-------------1--111----11-11----------1-11----1-1--11111111111--1111111-11111111-----111111111111111111111111-11111111111-1111111111111111111-11111111111111111111111-----------------------------111111111111111111111111111111-1111111111111111111111111111111111111111111111-11111-1111--11111111111111111111111111111-1-111111111-1111111-11-1--11111111111111111111---111111----11111111111111111-111111111111111111111111--11111111111111111111111111-11111111111111--111-1111111212111111-11111--1111111111111111111111111111111111111111---111111-----11111111111111111-111111--------------------------------------1--1-111111 ------1-----11111111122343311111111111111111-11111111111111211111111-1111111111111111111-11111111111-11112-11-------------------------------------------------1----------------11118111111332122112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 95.2 SQ:SECSTR cHHHHHHHHHHHHTTccEEEEEEETTcccHHHHHHHHHHHHHHTcccEEEEccccccTTccHHHHHHHHHHHHTTccHHHHHHHHHHHHcccccEEEEEcHHHHHTTcHHHHHHHHHHHTccEEEETTccGGGcHHHHHHHHHTTcEEEcEEcTTccHHHHHHHHHHccccEEEEccHHHHHHHHTTccHcHHHHHHHHHHHHTTcccEEEEcccccHHHHHHHHTTccEEEEcHHHHHHHHTTTcHHHHHHHHHHH############# DISOP:02AL 266-270| PSIPRED ccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHccEEEEHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //