[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55213.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->58 1a4sA PDBj 2e-04 43.2 %
:RPS:PFM   5->108 PF10861 * DUF2784 1e-17 46.6 %
:HMM:PFM   3->114 PF10861 * DUF2784 3e-42 43.2 111/112  
:BLT:SWISS 22->58 BADH_GADCA 6e-04 43.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55213.1 GT:GENE AAZ55213.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1371605..1371991 GB:FROM 1371605 GB:TO 1371991 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55213.1 GB:DB_XREF GI:71915311 LENGTH 128 SQ:AASEQ MRYPLIADTVMAVHFAFLAYLVCGGVLAWRWPRMFWPHLAAAAYGLGTVVVGWPCPLTRLENWARSKAGQQGLDPGGFISHYLTGVLYPADRLPHVQAAVGVIVVLSWAGALWTVRRRSPTALRLPHR GT:EXON 1|1-128:0| BL:SWS:NREP 1 BL:SWS:REP 22->58|BADH_GADCA|6e-04|43.2|37/100| TM:NTM 3 TM:REGION 6->28| TM:REGION 35->57| TM:REGION 87->109| BL:PDB:NREP 1 BL:PDB:REP 22->58|1a4sA|2e-04|43.2|37/503| RP:PFM:NREP 1 RP:PFM:REP 5->108|PF10861|1e-17|46.6|103/114|DUF2784| HM:PFM:NREP 1 HM:PFM:REP 3->114|PF10861|3e-42|43.2|111/112|DUF2784| OP:NHOMO 41 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -----------------11-1----111111-----1111--1---------------------11----2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------------1-1----11---------------1--------1--------------1--------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------1-11--1111--1---111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 28.9 SQ:SECSTR #####################EEEEEcccccHHHHHHHHHHHHHHTTcEEEEEccTTc###################################################################### DISOP:02AL 127-128| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //