[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55226.1
DDBJ      :             Phenylacetic acid degradation-related protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  317/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:141 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   23->132 1vi8G PDBj 1e-23 52.4 %
:RPS:PDB   20->135 2cy9A PDBj 2e-17 23.1 %
:RPS:SCOP  1->139 1sh8A  d.38.1.5 * 8e-20 20.6 %
:HMM:SCOP  1->138 1o0iA_ d.38.1.5 * 5.1e-28 33.1 %
:HMM:PFM   50->127 PF03061 * 4HBT 1.3e-18 29.5 78/79  
:BLT:SWISS 21->136 Y3380_VIBCH 6e-24 45.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55226.1 GT:GENE AAZ55226.1 GT:PRODUCT Phenylacetic acid degradation-related protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1384942..1385367) GB:FROM 1384942 GB:TO 1385367 GB:DIRECTION - GB:PRODUCT Phenylacetic acid degradation-related protein GB:PROTEIN_ID AAZ55226.1 GB:DB_XREF GI:71915324 InterPro:IPR003736 LENGTH 141 SQ:AASEQ MAVDGEKLAELLGHNPNLGGLAERMGMELLEASTERVVGRIPVEGNTQPYGLLHGGASCVLAESLGSIGSALLAAPDRIAVGIEINATHHRSVTSGWVTGVAVPVHTGRTLATWDIEITDDQGRRVCTSRLTCMLRDAPGR GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 21->136|Y3380_VIBCH|6e-24|45.7|116/150| BL:PDB:NREP 1 BL:PDB:REP 23->132|1vi8G|1e-23|52.4|103/137| RP:PDB:NREP 1 RP:PDB:REP 20->135|2cy9A|2e-17|23.1|108/116| HM:PFM:NREP 1 HM:PFM:REP 50->127|PF03061|1.3e-18|29.5|78/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 1->139|1sh8A|8e-20|20.6|136/153|d.38.1.5| HM:SCP:REP 1->138|1o0iA_|5.1e-28|33.1|136/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 394 OP:NHOMOORG 323 OP:PATTERN -------------------------------------------------------------------- ----11-1111-1--11-------------------1233-1-1-1111111122112--11111111111-----------------1111-1111--1-111-1111----------------11111111111---11---1--------------------------------------21111---1-1111111111111111--1111111111----111111--11111111111111111111--1----1-----11---1-111---------------------------------------------------------------------------1---------1-----------------1--------------------------------1--1-------------------------------------------------------------------------------11-------------------------------------------1111-1111----------------11---1--1-1---------1--------1-----------------------------------111-1----111111111111111111111-------------222212-2222222222-223222222222222222222211111222222222222222212222222--111111111111----11111---------111111111111111------------1111-1111----1111----------111111111111111111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 100.0 SQ:SECSTR ccccHHHHHHHHHHHHTTccccccccccccEEccccEEEEEccTTTccTTccccHHHHHHHHHTTTcGGccTTccTTcEccEEEEEEEEccccTTcEEEEEccEEEccccEEEEEEEEEETTccEEEEEEEEEEcEcHHHH PSIPRED ccccHHHHHHHHHccccHHHHHHHHcEEEEEEEccEEEEEEEcccccccccEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEEcccc //