[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55235.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   104->153 PF11259 * DUF3060 1e-04 52.0 %
:HMM:PFM   94->153 PF11259 * DUF3060 1.2e-22 51.7 60/61  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55235.1 GT:GENE AAZ55235.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1399264..1399755 GB:FROM 1399264 GB:TO 1399755 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55235.1 GB:DB_XREF GI:71915333 LENGTH 163 SQ:AASEQ MRCRVAALTSAVALAVAAVAGCSGGLSLRDDSGAGISIDEDGDISVGDGTTEIEISGGGSPGSSDGGALVTDELITIATDGGTVDQECGGRSVNVVANSATVALTGSCALLTITGSDNQVSVESATEVSVLGSNNTVRYASGDPVVTDLGSGNSVEPGGSSAP GT:EXON 1|1-163:0| TM:NTM 1 TM:REGION 4->26| SEG 5->28|vaaltsavalavaavagcsgglsl| SEG 56->67|sgggspgssdgg| SEG 92->103|svnvvansatva| RP:PFM:NREP 1 RP:PFM:REP 104->153|PF11259|1e-04|52.0|50/61|DUF3060| HM:PFM:NREP 1 HM:PFM:REP 94->153|PF11259|1.2e-22|51.7|60/61|DUF3060| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------11----1---1------1111----------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 155-163| PSIPRED cccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccEEccccccEEEEccccccccccccccccccEEEEEEcccEEEEcccccEEEEEEcccEEEEEEcccEEEEEccccEEEEEEccEEEEEEcccEEEEcccccEEEEcccccEEEccccccc //