[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55243.1
DDBJ      :             condensin subunit ScpB
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  551/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:193 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->164 2z99A PDBj 1e-42 55.3 %
:RPS:PDB   6->92 1bibA PDBj 1e-04 14.7 %
:RPS:SCOP  13->87 1t6sA1  a.4.5.60 * 7e-16 32.0 %
:HMM:SCOP  6->88 1t6sA1 a.4.5.60 * 1.3e-19 48.2 %
:HMM:SCOP  89->164 1t6sA2 a.4.5.60 * 3.5e-21 55.3 %
:RPS:PFM   17->173 PF04079 * DUF387 2e-34 54.8 %
:HMM:PFM   16->173 PF04079 * DUF387 9.7e-58 51.0 157/159  
:BLT:SWISS 13->173 SCPB_MOOTA 4e-30 46.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55243.1 GT:GENE AAZ55243.1 GT:PRODUCT condensin subunit ScpB GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1406879..1407460 GB:FROM 1406879 GB:TO 1407460 GB:DIRECTION + GB:PRODUCT condensin subunit ScpB GB:PROTEIN_ID AAZ55243.1 GB:DB_XREF GI:71915341 InterPro:IPR005234 LENGTH 193 SQ:AASEQ MSRTTSEVDLTVLRRNLEAVLMVVDQPVSAYELARAFGTDVETVTRVLRETAREYTEQGRGFDLREVAEGWRFYTRPECAEAVEHFLRDGHEVRLTQAALETLAVVAYRQPVSRGKVSAIRGVNCDGVMRTLVLRGLIEEAGQDPESGAILYRTTSYFLERLGLRSLDELPDLAPFLPDDIEGLDDTGEQATR GT:EXON 1|1-193:0| BL:SWS:NREP 1 BL:SWS:REP 13->173|SCPB_MOOTA|4e-30|46.2|160/195| BL:PDB:NREP 1 BL:PDB:REP 6->164|2z99A|1e-42|55.3|159/160| RP:PDB:NREP 1 RP:PDB:REP 6->92|1bibA|1e-04|14.7|75/294| RP:PFM:NREP 1 RP:PFM:REP 17->173|PF04079|2e-34|54.8|157/160|DUF387| HM:PFM:NREP 1 HM:PFM:REP 16->173|PF04079|9.7e-58|51.0|157/159|DUF387| RP:SCP:NREP 1 RP:SCP:REP 13->87|1t6sA1|7e-16|32.0|75/85|a.4.5.60| HM:SCP:REP 6->88|1t6sA1|1.3e-19|48.2|83/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 89->164|1t6sA2|3.5e-21|55.3|76/0|a.4.5.60|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 570 OP:NHOMOORG 557 OP:PATTERN -----------------------1------------------------1-----111----------- 1111111111111111111-11111111111111111111111111-111111111-1--111-1111111----11111111----------------------11-1---------------111111111-1111111---11---------------------------------------1111111111111111111111111111111111111111111111111111111-111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-111111111-111111111-----21-111-11-11-11111111112------1--45-----3--1---1112111111111111-1111111111111111-----------------------------11111-111111111111111111111111111111111111111111111111111111111111-111111111111-1-----------111111111111111-----------------------------11-111-111-1111111111111111111--11111--------------------------------------------------------------------------------------------11111111111111----------------11111111111111111111111111111------------------------11111111111111----111111--------11-------11-11111111-1111111-----1-1-1-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 82.4 SQ:SECSTR #####cHHHHHHHHHHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTEEETTTTcccEEETTTEEEcccccccccHHHHHHTcccHHHTTGGGccTTcEEEEcccTTccEEcccHHHHTccHHHHHHHHHHHccccccEEEcEEEEEcHHHHHHHcc############################# DISOP:02AL 1-3, 183-193| PSIPRED cccccccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEEEHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHcccEEEcccccccccEEEcccHHHHHHcccccHHHccccccccHHHHHHHHHccccccc //