[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55244.1
DDBJ      :             pseudouridine synthase, Rsu
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  867/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   133->369 1kskA PDBj 6e-30 38.6 %
:RPS:PDB   134->373 3dh3B PDBj 6e-38 29.4 %
:RPS:SCOP  135->186 1vioA2  d.66.1.5 * 5e-11 25.5 %
:RPS:SCOP  196->369 1kskA4  d.265.1.3 * 2e-36 37.9 %
:HMM:SCOP  104->202 1jh3A_ d.66.1.4 * 3.5e-12 29.6 %
:HMM:SCOP  178->375 1przA_ d.265.1.3 * 6.8e-44 36.5 %
:RPS:PFM   196->327 PF00849 * PseudoU_synth_2 1e-14 50.4 %
:HMM:PFM   197->331 PF00849 * PseudoU_synth_2 2e-26 33.3 135/164  
:HMM:PFM   136->177 PF01479 * S4 1.5e-12 45.2 42/48  
:BLT:SWISS 132->375 Y1738_MYCBO 1e-69 54.9 %
:PROS 237->251|PS01149|PSI_RSU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55244.1 GT:GENE AAZ55244.1 GT:PRODUCT pseudouridine synthase, Rsu GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1407441..1408568 GB:FROM 1407441 GB:TO 1408568 GB:DIRECTION + GB:PRODUCT pseudouridine synthase, Rsu GB:PROTEIN_ID AAZ55244.1 GB:DB_XREF GI:71915342 InterPro:IPR000748 InterPro:IPR002942 InterPro:IPR006145 LENGTH 375 SQ:AASEQ MNKPHDDSIRRRGGGRPRGGRGHFEQTGRREHRDRRGAHFDQDTGDDRRTAPGRKQRDGQRGERTQRAQAERRQRHAHDPRARRSGRGGRGAERGLSPQARARLRILRDEYDPWDDDPVDPDEERDTYVDVPGGIRLQKALAQAGVASRRACEELIAAGRVSVDGQIVRRFGARVDPEKSEIRVDGMRVVTSQNLRYYALNKPRGVVSTMFDPEGRPTIGDYAAQIGPIEERLFHVGRLDTDTEGLILLTNDGELANRLTHPRYKVTKTYLAKVPGPVPRDVIRQIRKGVELDDGFVKVDSFRVIDNIEPKALVEIRLHEGRKHIVRRLMKAVGHPVSDLARTQIGPVGLNNLKSGTIRALTSQEVSELYTAAGM GT:EXON 1|1-375:0| BL:SWS:NREP 1 BL:SWS:REP 132->375|Y1738_MYCBO|1e-69|54.9|244/254| PROS 237->251|PS01149|PSI_RSU|PDOC00885| SEG 10->22|rrrgggrprggrg| SEG 59->75|gqrgertqraqaerrqr| SEG 81->95|rarrsgrggrgaerg| SEG 109->126|deydpwdddpvdpdeerd| BL:PDB:NREP 1 BL:PDB:REP 133->369|1kskA|6e-30|38.6|228/230| RP:PDB:NREP 1 RP:PDB:REP 134->373|3dh3B|6e-38|29.4|231/241| RP:PFM:NREP 1 RP:PFM:REP 196->327|PF00849|1e-14|50.4|129/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 197->331|PF00849|2e-26|33.3|135/164|PseudoU_synth_2| HM:PFM:REP 136->177|PF01479|1.5e-12|45.2|42/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 135->186|1vioA2|5e-11|25.5|51/58|d.66.1.5| RP:SCP:REP 196->369|1kskA4|2e-36|37.9|169/172|d.265.1.3| HM:SCP:REP 104->202|1jh3A_|3.5e-12|29.6|98/99|d.66.1.4|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 178->375|1przA_|6.8e-44|36.5|197/252|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2031 OP:NHOMOORG 900 OP:PATTERN -------------------------------------------------------------------- 1221121111111111111-11111111111111111111111111111111111111--11111111111-1111111111121222111112-11--21322142412-1111111-11111111111111111111111111112122222222222112122222221211111211111112222-232-4444444444444422222244422233332222223332222222222222222222-11222211122211222222214334443333323444444433343333333333333343334444323324222222242422223344232222221111122111222222-22111333311111121111111111111111111111-3322222212112111222222221134122111112221111111111111222------------1111111111111-----1212-2222243333434444333244444444344443333332344422232433454444334333322233421113111111111111111121111213111211111111111111111112111233442355624545666567655555-67567--2111211111143333444444444444-4444444444444444444444333344444444444444444544434442-433343333444--2211111222224234333333333333323222222344333333333333-33333331111111113544644444445445455555555111111122211111111111121311111-21111--11111--12---2212211111122 11--22--311-------------------------------------------------------------------------------------------------41-----------------------------------------------------3---------1-1-15A433111111-114332222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 64.5 SQ:SECSTR ###################################################################################################################################TTcEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHEEETETcccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEEcccEEEccEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHHHHHHHHTc## DISOP:02AL 1-129| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHcccEEEccEEEcccccEEcccccEEEEccEEEEEccccEEEEEEccccEEEEcccccccHHHHHHHHHHccccccEEEEccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHccccccEEccEEEEEEEccccEEEEEEEEEcccHHHHHHHHHHHccEEEEEEEEEEccEEcccccccccccccHHHHHHHHHHHcc //