[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55270.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->202 2np3B PDBj 5e-11 35.1 %
:RPS:PDB   41->203 2dg7A PDBj 5e-14 20.4 %
:RPS:SCOP  41->81 1z77A1  a.4.1.9 * 4e-10 34.1 %
:RPS:SCOP  96->202 2np3A2  a.121.1.1 * 1e-22 28.7 %
:HMM:SCOP  18->106 1t33A1 a.4.1.9 * 1.3e-15 31.8 %
:HMM:SCOP  95->205 2np3A2 a.121.1.1 * 2.6e-28 34.2 %
:RPS:PFM   42->76 PF00440 * TetR_N 3e-05 51.4 %
:HMM:PFM   34->80 PF00440 * TetR_N 8.9e-18 44.7 47/47  
:BLT:SWISS 41->125 ACNR_CORGL 2e-05 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55270.1 GT:GENE AAZ55270.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION complement(1435123..1435779) GB:FROM 1435123 GB:TO 1435779 GB:DIRECTION - GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAZ55270.1 GB:DB_XREF GI:71915368 InterPro:IPR001647 LENGTH 218 SQ:AASEQ MTGQVSWDHDPLASPDSPDKRPWTAKGLRARRRILAAARKCFAEVGYEKATLRMIAAEANSDKSSVIKYFGSKEQLFRECVYWTIPIDELTADAPDQSAENYLRSMLSAWARDPHSPMAVLLRVSMTNKEAADLLRSHITTHSVERVMKHMKGPDPELRAGLFAAMMMGIASGRYLLRIPGLAEAELDDVLRVAAPAIRALIAVEEGTDSTEEKQDRT GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 41->125|ACNR_CORGL|2e-05|34.2|79/188| SEG 25->40|akglrarrrilaaark| BL:PDB:NREP 1 BL:PDB:REP 41->202|2np3B|5e-11|35.1|148/174| RP:PDB:NREP 1 RP:PDB:REP 41->203|2dg7A|5e-14|20.4|157/185| RP:PFM:NREP 1 RP:PFM:REP 42->76|PF00440|3e-05|51.4|35/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 34->80|PF00440|8.9e-18|44.7|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 41->81|1z77A1|4e-10|34.1|41/75|a.4.1.9| RP:SCP:REP 96->202|2np3A2|1e-22|28.7|101/104|a.121.1.1| HM:SCP:REP 18->106|1t33A1|1.3e-15|31.8|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 95->205|2np3A2|2.6e-28|34.2|111/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 49 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----1---------2------1--53-----31222123211-----1----1-------11-11112212------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 78.9 SQ:SECSTR ########################################HHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTccccHHHHHHTcccHHHHHHHHHHHTTTTTTccTTHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHcccHHH###### DISOP:02AL 1-33, 206-218| PSIPRED ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccccc //