[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55278.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   115->153 3e0rA PDBj 4e-04 17.9 %
:HMM:SCOP  1->155 1r9cA_ d.32.1.2 * 2.2e-07 24.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55278.1 GT:GENE AAZ55278.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1444756..1445217 GB:FROM 1444756 GB:TO 1445217 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55278.1 GB:DB_XREF GI:71915376 InterPro:IPR002110 LENGTH 153 SQ:AASEQ MATPVHWKLVIDAHDPHAQADFWAAALHYEVEDNSALIEQLLDQGVVSPEILTEHHGRRAWRDAAAIRHPDDPYDPHSGTGLGRRVLFNRVPLAEKKTTKNRVHIDLHPPRGERDAEVARLRGLGAQVYRHVKEASGEWVVMTDPEGNEFCVH GT:EXON 1|1-153:0| RP:PDB:NREP 1 RP:PDB:REP 115->153|3e0rA|4e-04|17.9|39/235| HM:SCP:REP 1->155|1r9cA_|2.2e-07|24.4|119/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 55 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----2----------------2----------21111122-1-1-4-2-11-111121--112-3322252---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 39 STR:RPRED 25.5 SQ:SECSTR ##################################################################################################################HHHHHHHHTTcccccEEEEccccEEEEEEcTTccEEEEE DISOP:02AL 1-2| PSIPRED ccccEEEEEEEEcccHHHHHHHHHHHHccEEccccccHHcccccccccccHHccccccccccccEEEcccccccccccccccccEEEEEEcccccccccccEEEEEEEcccHHHHHHHHHHHHcccEEEEccccccccEEEEEcccccccccc //