[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55283.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->147 PF02481 * DNA_processg_A 2.4e-05 20.0 135/212  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55283.1 GT:GENE AAZ55283.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1449849..1450328 GB:FROM 1449849 GB:TO 1450328 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55283.1 GB:DB_XREF GI:71915381 LENGTH 159 SQ:AASEQ MRIGITGHSNLTADSMDLVRQALTEALTPYADGELVGVSCLARGADQLFAEAVLAVGGQLEVVLPSADYRETKVKPDNLEQFDRLLVRSSLVRYMSHLTAGRQAYEDANEAVIGSVDRLFAVWDGQPASGKGGTADAVAAARARGVPVDVIWPEGARRE GT:EXON 1|1-159:0| SEG 130->150|gkggtadavaaarargvpvdv| HM:PFM:NREP 1 HM:PFM:REP 3->147|PF02481|2.4e-05|20.0|135/212|DNA_processg_A| OP:NHOMO 16 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----121---1------------1---2-11121---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 157-159| PSIPRED cEEEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHccEEEEEEcccccEEcccccccHHHHHHHHHccccEEEcccccccHHHHHHHHHHHEEcccEEEEEEccccccccccHHHHHHHHHHcccEEEEEcccccccc //