[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55287.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->62 PF08808 * RES 0.00035 28.1 32/170  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55287.1 GT:GENE AAZ55287.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1453321..1453674 GB:FROM 1453321 GB:TO 1453674 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55287.1 GB:DB_XREF GI:71915385 LENGTH 117 SQ:AASEQ MARPIPGRAYRLLPGTPARGNRHLTSAGTDHPSPLPAPVPAHRPYSGTRMNHIDHPVTLYAGPLDGLVMPAAELEELVREYCGDRLVFLSCFGVSGLYQEQDGQWVYAAPGLLDKKR GT:EXON 1|1-117:0| HM:PFM:NREP 1 HM:PFM:REP 20->62|PF08808|0.00035|28.1|32/170|RES| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 115-117| PSIPRED ccccccccEEEEcccccccccEEEccccccccccccccccccccccccccccccccEEEEEcccccEEEcHHHHHHHHHHHcccEEEEEEccccccEEEEcccEEEEEccccccccc //