[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55296.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->165 2zbqA PDBj 1e-07 33.7 %
:RPS:PDB   33->192 3dlcA PDBj 2e-13 13.8 %
:RPS:SCOP  33->155 2avnA1  c.66.1.41 * 9e-16 25.9 %
:HMM:SCOP  21->238 1wznA1 c.66.1.43 * 2.4e-28 25.0 %
:RPS:PFM   28->160 PF05401 * NodS 2e-11 33.8 %
:HMM:PFM   63->155 PF08241 * Methyltransf_11 2.3e-13 33.7 92/95  
:BLT:SWISS 40->156 Y092_MYCBO 1e-11 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55296.1 GT:GENE AAZ55296.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1462776..1463492 GB:FROM 1462776 GB:TO 1463492 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ55296.1 GB:DB_XREF GI:71915394 InterPro:IPR000051 LENGTH 238 SQ:AASEQ MPRVRTVKEDHRAGVWCARGMTGLLRRLHAVLDEFNAAYPWDHNAYYHRWILRQLPPRFGRALDAGSGSGDLARLLAGRADRVCGIDIDPVITARARELTDPAAPVVFTVGDVLTDTPAGPYDVVTCVAAVHHMPLAEALTCFRDLLAPGGTLVVVGLYRAHDPIDVLLDGVSVVLNPLIGWVRHRGRRAPRPVSMTAVTTPATMTFAEIVAEARRVLPRARLRRRLLWRYTLVWRKP GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 40->156|Y092_MYCBO|1e-11|36.2|116/197| SEG 214->236|arrvlprarlrrrllwrytlvwr| BL:PDB:NREP 1 BL:PDB:REP 61->165|2zbqA|1e-07|33.7|101/251| RP:PDB:NREP 1 RP:PDB:REP 33->192|3dlcA|2e-13|13.8|160/215| RP:PFM:NREP 1 RP:PFM:REP 28->160|PF05401|2e-11|33.8|133/148|NodS| HM:PFM:NREP 1 HM:PFM:REP 63->155|PF08241|2.3e-13|33.7|92/95|Methyltransf_11| GO:PFM:NREP 3 GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF05401|IPR008715| GO:PFM GO:0009312|"GO:oligosaccharide biosynthetic process"|PF05401|IPR008715| GO:PFM GO:0009877|"GO:nodulation"|PF05401|IPR008715| RP:SCP:NREP 1 RP:SCP:REP 33->155|2avnA1|9e-16|25.9|116/246|c.66.1.41| HM:SCP:REP 21->238|1wznA1|2.4e-28|25.0|216/0|c.66.1.43|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 29 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----1---11----2--11-1-----11111-1---11---1--1-11-----------------12-211------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 89.5 SQ:SECSTR cccGGGGTTTcccccccccccccccccHHHHHHHHHHTTTTTHHHHHHHHHHHHHcccEEEEEEETcTTcHHHHHHHHHEEEEEEEEccHHHHHHHHHTTcTTTEEEEEccTTcccccTTcEEEEEEEccGGGccHHHHHHHHHHHEEEEEEEEEEEccccHHHHHHHHHHHHHcTTHHHHHHHHccHHHHHcEEEEEEEcccHHHHHHHHHH######################### DISOP:02AL 1-5| PSIPRED ccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccccEEEEEccHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEcc //