[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Thermobifida fusca YX (tfus0)
Gene : AAZ55302.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   109->157 PF00487 * FA_desaturase 1.6e-05 20.4 49/257  
:HMM:PFM   54->89 PF05036 * SPOR 0.00015 19.4 36/76  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ55302.1 GT:GENE AAZ55302.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00263CH01 GT:ORG tfus0 GB:ACCESSION GIB00263CH01 GB:LOCATION 1468847..1469431 GB:FROM 1468847 GB:TO 1469431 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ55302.1 GB:DB_XREF GI:71915400 LENGTH 194 SQ:AASEQ MDDWTAPLGAAVPENAEPLCGPAQVDESTEAMMNGPEFNAPSGSIPAQRGQRRIASYATYAEAQRLVDRMSDRGFPVEHVRIIGDGVRTVEQVTGRMTKVKAALAGAGTGAWLGLFVGLLFGLFAIGPAWFWVILVSVAIGALWGAVFGFAAHWATRGQRDFSSVQSLQAERYDVYVNAMHAAQAERFRQEANL GT:EXON 1|1-194:0| TM:NTM 2 TM:REGION 102->124| TM:REGION 133->155| SEG 102->124|aalagagtgawlglfvgllfglf| HM:PFM:NREP 2 HM:PFM:REP 109->157|PF00487|1.6e-05|20.4|49/257|FA_desaturase| HM:PFM:REP 54->89|PF05036|0.00015|19.4|36/76|SPOR| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN -------------------------------------------------------------------- ------11-------1111-12--1111111-1111--------111----1111121--11--11----1-----------1-----------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 23-49, 191-194| PSIPRED ccccccccccccccccccccccccccccccHHccccccccccccccccccccEEEEcccHHHHHHHHHHHHHccccHHHEEEEEcccEEEEEEEEEEcHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHEEEcEEEEEEccHHHHHHHHHHHHccc //